(data stored in ACNUC7421 zone)

EMBL: CP000489.PE132

CP000489.PE132       Location/Qualifiers
FT   CDS_pept        117381..118250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0132"
FT                   /product="putative replication protein A"
FT                   /note="KEGG: nwi:Nwi_0846 possible replication protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68249"
FT                   /db_xref="InterPro:IPR018777"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYA5"
FT                   /protein_id="ABL68249.1"
FT                   /translation="MSSPISARRICGGRQMELFRPVASDIAARDSRDLMSWPFFSLAKS
FT                   RRVVPIDFHMGPVSIRVEATPEHGMATIWDADILIWAASQIVEARNQGLRTSRLMAATP
FT                   YEILTFIRRGDSARSYLRLKAALDRLQSTTVATSIRQPAERRRHRFSWINEWKELLDDQ
FT                   RRPLGIELILPDWFYAGVMDDALVLTIDRAYFDLKGGLERWLYRLVRRHGGRQPGGWSF
FT                   DLRHLHLKSGSLSPFKRFAFEVRAIVQRQPLPGYRLSLAVGSDGLPRLCFQPAPANPFA
FT                   AAPRAARR"
     gtgagttccc ccatttccgc gcgccgcatc tgcggcggcc ggcagatgga actgttccgg        60
     ccggtcgcca gcgacattgc cgcccgcgat tcccgcgatc tgatgtcctg gccgttcttt       120
     tcgttggcca agtcccgccg cgttgtgccg atcgatttcc acatggggcc ggtgtcgatc       180
     cgcgtggagg cgacgccgga acatggcatg gccacgatct gggatgccga catcctgatc       240
     tgggcggcca gccagatcgt cgaggcccgc aaccagggct tgcggacctc gcgtctgatg       300
     gccgcgacgc cctacgagat cctcaccttc atccggcgcg gcgattccgc ccgcagctac       360
     ctgcggctca aggccgccct cgaccgcttg caatcgacga cggtcgccac ctcgatccgc       420
     cagccggcgg aacggcggcg gcaccggttt tcctggatca acgaatggaa ggaactgctc       480
     gacgatcaac gcaggccgct cgggatcgaa ctgatcctgc ccgactggtt ctatgccggg       540
     gtgatggacg atgcgctggt cctgaccatc gaccgcgctt atttcgacct caagggcggg       600
     ctggagcgct ggctctaccg tctggtgcgc cgccacggcg gccgccagcc cggtggctgg       660
     agtttcgatc tccggcacct gcacctgaaa tccggcagcc tgtcgccctt taagcgcttc       720
     gccttcgaag tccgggccat cgtccaaaga cagccgctgc ccggctatcg cctgtcgctg       780
     gccgtcggtt ccgacgggct gccgcggctg tgtttccaac cagcccccgc caatcccttc       840
     gccgccgcgc ctcgcgccgc gcgtcggtga                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page