(data stored in ACNUC7421 zone)

EMBL: CP000489.PE134

CP000489.PE134       Location/Qualifiers
FT   CDS_pept        119003..120622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0134"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: C-5 cytosine-specific DNA methylase;
FT                   transposase IS116/IS110/IS902 family protein; KEGG:
FT                   mlo:mll5964 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68251"
FT                   /db_xref="GOA:A1AYA7"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYA7"
FT                   /protein_id="ABL68251.1"
FT                   /translation="MTMPRASLSLPLHVLDLFSGAAGGWSLGLHRAGFMTIAACEIVEW
FT                   RRILYSENFPHVRLYADIRDLTATRLVSDLGCLPDIVVGSPPCQDISSANTKGKGIEGE
FT                   RSGLYLEAVRLVGECRPRWFAFENRSYGCLPEAAVVRLWARQMVKEAAMNTQVHQHKSH
FT                   VIAHDEVSAIFISLELSKSTWLVTSISPGAGEKMSRHTVKGGDVAALMDRFDALRHKAL
FT                   QRTGRDFPIVTIHEAGLDGFWIHRILEREGVESHIVDAASIAVPRRHRRVKTDKVDGET
FT                   LVRTLLAWKRGEPRVCSMVRVPSPEDEDRRRPSRERKVLIAERVSHVNRIKGLLYSQGV
FT                   AYEPLHRNRRQNLEELRTGDGRPLSPCLKRQILRELDRLELLLEQIRNVEAERDADLKE
FT                   ERKTDTPPVGVLAALKGIGPEFAAVIWAEGLSRPFENRRQVAAYAGLAPTPWQSGSVNR
FT                   EQGVSKSGNPRLRTTMIQLAWLWLRHQPRSELSCWFQQRVAGHGGRVRKTMIAAMARKL
FT                   LVALWKYLTAGVVIEGAAMKTV"
     atgaccatgc cgcgtgcgtc tctttccctg ccgctgcatg tgctcgatct gttcagcggt        60
     gccgccggcg gctggtctct cggcctgcac cgggcggggt tcatgaccat cgccgcctgc       120
     gagatcgtgg aatggcgccg catcctctat tcggagaatt ttccgcatgt cagactctac       180
     gccgatatcc gcgacctcac ggcaactcga cttgtttccg acctcggctg cctgcccgac       240
     atcgtcgtcg gctcgccgcc ctgccaggac atcagcagcg ccaacacgaa ggggaagggg       300
     atcgagggcg aacgctcggg cctctacctc gaggccgtgc gcctggtcgg agagtgccgc       360
     cctcgctggt tcgcttttga gaacagatcc tatggctgtt tgccggaggc cgctgtcgtg       420
     cggttatggg caaggcaaat ggtcaaggag gcagccatga atacgcaggt tcatcaacat       480
     aaatcgcacg tcatcgctca tgacgaggtt tcagcgatat tcatatcctt ggaattaagc       540
     aaatcgacct ggctggtgac gtcgatttct ccgggcgcgg gggaaaaaat gtcccggcat       600
     accgttaagg gcggcgatgt ggcggccctg atggaccgat ttgatgcgct tcgtcataaa       660
     gccctgcaaa gaaccggccg tgactttccg attgtgacaa tccatgaggc cggcctggac       720
     gggttctgga tacatcgtat cctcgaacgg gaaggcgtcg aaagccacat tgtcgatgcg       780
     gcgtcgattg cagtgccgcg gcggcatcgg cgtgtgaaaa ccgacaaggt cgatggcgaa       840
     accctcgtca ggacgttgct ggcctggaaa cggggggagc cgcgggtctg ttcgatggtc       900
     cgcgtgccct ctccggagga tgaggacagg cgccgaccgt cgcgggagcg caaggttctg       960
     atcgcggaac gtgtcagcca cgtcaaccgc atcaaggggc tgctttattc gcaaggcgtg      1020
     gcctatgaac ccctgcatcg caatcgccgg cagaatctgg aagagctgcg cactggcgac      1080
     gggcgcccgc tttcgccctg cctgaaacga cagatcctgc gcgaactcga tcgcctcgaa      1140
     ctgcttctgg agcagatcag gaacgtcgag gcagagcgcg acgccgacct gaaagaggaa      1200
     cgtaaaaccg atacgccgcc ggttggggtt ctggccgcgc tgaaaggtat cggccctgag      1260
     ttcgcggccg tgatctgggc cgaggggctg tcacgcccgt ttgagaaccg acggcaagtg      1320
     gcagcctacg cgggcctggc accgacacca tggcaaagcg gttccgtgaa ccgggagcag      1380
     ggtgtcagca aatccggcaa tcccaggctg cgaacgacca tgatccagct tgcctggctc      1440
     tggctgcgtc atcagcctcg ttccgagctg agctgctggt tccagcagcg cgtggccggc      1500
     catggcggtc gtgtccgcaa gaccatgatc gccgccatgg cgagaaaact gcttgtcgcc      1560
     ctgtggaagt acctcacggc cggcgtcgtc atcgaaggtg ccgccatgaa gacggtttga      1620
//

If you have problems or comments...

PBIL Back to PBIL home page