(data stored in ACNUC7421 zone)

EMBL: CP000489.PE135

CP000489.PE135       Location/Qualifiers
FT   CDS_pept        121111..121665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68252"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYA8"
FT                   /protein_id="ABL68252.1"
FT                   /translation="MRLEGESGARKAMKDSGLSDLFRNRPLPTPMASDGMKDGAGGGAG
FT                   STYPLRMNLATPRKTDADRGGRGDLLSQLRGHNSRHAGMSRAPETLPTPTKRDSRMDGW
FT                   SPAYDRRKSPTMDAVMDGAMTNRAPDKWAGARALAAILRNHGLTGTAALPITYGWMMGF
FT                   PPGWLARALRSAVARGRLRRA"
     atgcggctgg agggcgaatc gggggcacgg aaggcgatga aggactcggg tctctccgac        60
     ctgttccgca accgcccgct gccgacaccg atggcctcgg acgggatgaa ggacggtgcc       120
     ggcggcggcg cgggatcgac atatccgctg cggatgaacc tcgccacgcc gcggaagacg       180
     gacgcggatc gcggcggccg gggcgacctt ctcagccagc ttcggggcca caacagccgc       240
     catgcgggga tgtcacgggc tcccgaaacc ctgccgacgc cgaccaaacg cgacagccgc       300
     atggacggct ggagcccggc ctacgaccgc cggaaatcgc cgacgatgga tgcggtgatg       360
     gacggcgcga tgaccaaccg ggcgccggac aaatgggccg gggcgcgggc gctggcggcg       420
     atcttgcgga accatggcct gactggaacg gcggcattgc ccatcacata cgggtggatg       480
     atgggatttc cgcctggctg gctcgcacgc gccttgcgct cggcagtcgc aaggggacgt       540
     ctgcggcgag cctga                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page