(data stored in ACNUC7421 zone)

EMBL: CP000489.PE14

CP000489.PE14        Location/Qualifiers
FT   CDS_pept        12091..12444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0014"
FT                   /product="protein of unknown function DUF454"
FT                   /note="PFAM: protein of unknown function DUF454; KEGG:
FT                   atc:AGR_C_4462 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68131"
FT                   /db_xref="GOA:A1AXY7"
FT                   /db_xref="InterPro:IPR007401"
FT                   /db_xref="UniProtKB/TrEMBL:A1AXY7"
FT                   /protein_id="ABL68131.1"
FT                   /translation="MRYLWFSMGWLTLTLGVIGVFVPVLPTVPFLLLAVWAFMRSSPRL
FT                   GARIMRHPQFGPPIRAWRKRGVIGRGAKIWAVAGMSAGVAWAVWLGLDPRFIAAQALAC
FT                   TAIAAWLVTRPEI"
     atgcgatatc tctggttctc catgggctgg ctgaccttga cgctgggcgt gatcggggtc        60
     ttcgtgccgg tcctgccgac cgtgccgttc ctgctgcttg cggtctgggc cttcatgcgc       120
     tcgtctcccc ggctgggcgc acgcatcatg cgccacccgc aattcggccc gccgatccgc       180
     gcctggcgca agcgcggcgt catcggccgc ggggccaaga tctgggccgt cgccggcatg       240
     tcggccggcg tcgcatgggc ggtctggctg ggccttgatc cgcgcttcat cgctgcgcag       300
     gcattggcct gcaccgccat cgccgcctgg ctggtgaccc gccccgagat ctga             354
//

If you have problems or comments...

PBIL Back to PBIL home page