(data stored in ACNUC7421 zone)

EMBL: CP000489.PE141

CP000489.PE141       Location/Qualifiers
FT   CDS_pept        126578..126934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0141"
FT                   /product="PilT protein-like protein"
FT                   /note="KEGG: rru:Rru_A0091 PilT protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68258"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYB4"
FT                   /protein_id="ABL68258.1"
FT                   /translation="MRAHSDRLYLSAITIAEIEAGIARAVRIGASAKAPALRRWLAAIE
FT                   HFYASRILPFGIGEARQAGAILDRARAHDSGFEDIAIAATAAAHDLTVLTANEQHFAPL
FT                   GVPFANPLKELPAP"
     atgcgcgccc atagcgaccg gctctatctc tcggccatca ccattgccga gatcgaggca        60
     ggcatcgccc gagcggtcag gatcggcgcc agcgccaagg ctccggcgct acgccgctgg       120
     ctcgccgcca tcgagcattt ctatgccagc cggattctgc ctttcggcat cggggaggcc       180
     cgccaggccg gagcgatcct cgaccgggcg cgcgcccatg attcgggttt cgaggacatc       240
     gccatcgctg cgactgcggc cgcgcatgac ctgacggtgc tgaccgccaa tgagcagcat       300
     ttcgcgccgc tcggcgtgcc tttcgccaat ccgctgaagg aattgcctgc gccgtag          357
//

If you have problems or comments...

PBIL Back to PBIL home page