(data stored in ACNUC7421 zone)

EMBL: CP000489.PE142

CP000489.PE142       Location/Qualifiers
FT   CDS_pept        127107..129131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0142"
FT                   /product="TRAG family protein"
FT                   /note="PFAM: TRAG family protein; KEGG: mes:Meso_0515 TraG
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68259"
FT                   /db_xref="GOA:A1AYB5"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYB5"
FT                   /protein_id="ABL68259.1"
FT                   /translation="MSGTKILWGQITVVFLIVLIFVWSGTQWTAWRLGFQPQLGPAWFA
FT                   LWGIPVYYPPALFWWWYFYDAYAPRIFVEGGIIAAAGGFLAIGTAIILSVMRAREAADV
FT                   ETYGSARWAERPEIERAGLLGPDGVVLGKLGADYLRHDGPEHVLCFAPTRSGKGVGLVV
FT                   PTLLTWPGSAIVHDIKGENWQLTAGFRARHGRVLLFDPTNAQSAAYNPLLEVRRGEWEV
FT                   RDVQNIADILVDPEGSLEKRNHWEKTSHALLVGVILHVLYAEEDKTLARVAAFLSDPRR
FT                   SIEATLAAMMKTPHLGEAGPHPVIASAARELLNKAENERSGVLSTAMSFLGLYRDPVVA
FT                   QVTSRCDWRIADLIAGEQPSTLYLVVPPSDISRTKPLIRLVLNQIGRRLTEDLRGKDDR
FT                   HRLLLMLDEFPALGRLDFFESALAFMAGYGIKSFLIAQSLNQIEKAYGPNNSILDNCHV
FT                   RVSFAANDERTAKRVSDALGTATEMKAMKNYAGHRLAPWLGHIMVSRSETARPLLTPGE
FT                   VMQLPPEDEIVMVAGTPPIRARKARYYVDPRFRERVLAPPDTREVMPSRQMDDWTGLPP
FT                   PKLDDVGQGAGAAAVPNAALAQVDTNSSGDSDNAGLRREPGLEPYQDIAPQPVTLPENE
FT                   FDPDFEAPEQQAVRNRGLARDMRRVARQISMNQDDGLEL"
     ttgtccggca cgaagatcct ctggggccag atcaccgtgg tcttcctgat cgtgctgatc        60
     ttcgtctggt ccggcacgca atggacggcc tggcggcttg gcttccagcc gcagctcggc       120
     ccggcctggt tcgctctctg gggcattccg gtctattacc cgccggccct gttctggtgg       180
     tggtacttct acgatgccta tgcgccacgc atcttcgtcg agggcggcat catcgctgcc       240
     gcgggcggat tcctcgccat cggcaccgcc atcatcctct cggtgatgcg cgcccgtgag       300
     gctgccgatg tcgagaccta cggctcggcg cgctgggcgg agcggcccga gatcgagcgg       360
     gccggactgc tcggccccga tggcgtggtg ctcggcaagc tcggcgcgga ctatctgcgc       420
     cacgacggcc cggaacatgt gctctgcttc gcaccgaccc gatccggtaa aggcgtcggg       480
     ctggtggtgc cgacgctgct gacctggccc ggctcggcca tcgtccatga catcaagggt       540
     gagaactggc agctcaccgc cgggttcagg gcacggcacg gccgggtgct gctcttcgat       600
     ccgaccaatg cccaatccgc cgcctacaac ccgttgctgg aggtgcgccg cggggaatgg       660
     gaggtgcgcg atgtccagaa catcgccgat atcctcgttg atcccgaggg ctcgctggaa       720
     aagcgcaacc attgggaaaa gaccagccat gcccttttgg ttggcgtgat cctgcatgtg       780
     ctctatgccg aggaggataa gaccctcgcg cgcgtcgccg ccttcctctc cgatccgcgc       840
     cggtcgatcg aggcgacgct ggcggcgatg atgaagaccc cgcatctcgg agaggccggc       900
     ccgcatccgg tcatcgccag cgccgcgcgc gagttgctga acaaggccga gaacgaacgc       960
     tcgggcgtgt tgtccaccgc catgtccttc ctcgggcttt accgcgatcc ggtggtggcc      1020
     caagtcacca gccgctgcga ctggcgcatc gccgatctga tcgcgggcga gcagccttcg      1080
     acgctttatc tggtggtgcc gccttccgac atctcgcgca ccaagccgct gatccggctg      1140
     gtgctgaacc agatcggccg gcgcctgacc gaggatctgc gcggcaagga cgaccggcac      1200
     cgcctgctgc tgatgctgga cgagttcccg gcgctgggac gactggattt cttcgaatcc      1260
     gccctggcct tcatggccgg ctacggcatc aagtccttcc tgatcgcgca atcgctcaac      1320
     cagatcgaga aggcctatgg cccgaacaat tcgatcctcg acaactgcca tgtccgggtc      1380
     agcttcgccg ccaacgacga gaggacggcc aaacgggtct ccgatgccct cggcaccgcc      1440
     accgagatga aggcgatgaa gaactatgcc gggcaccgcc tggcgccctg gctcggccat      1500
     atcatggtct cgcgctccga gaccgcccgg ccgctgctca cccccggcga ggtgatgcag      1560
     ctgccgcccg aggacgagat cgtcatggtg gcgggcaccc cgccgatccg ggcccggaag      1620
     gcgcgctact atgtcgatcc gcgtttccgc gagcgggtgc tggccccgcc cgatacgcgc      1680
     gaggtcatgc cttcacggca gatggatgac tggaccgggc tgccgccgcc aaagctggat      1740
     gatgtggggc agggggctgg tgctgccgcc gtgccgaatg ccgcgcttgc ccaggtcgac      1800
     accaattcat ccggggattc ggacaatgcc ggtctgcgcc gagagccagg actggagccc      1860
     tatcaggata tcgcgccgca gccggtgacg cttccggaga acgagttcga tcccgatttc      1920
     gaggcccccg agcagcaggc ggtccgtaac cggggactgg cgcgcgacat gcgtcgggtc      1980
     gcgcgccaga tctcgatgaa ccaggacgac ggattggagc tctga                      2025
//

If you have problems or comments...

PBIL Back to PBIL home page