(data stored in ACNUC7421 zone)

EMBL: CP000489.PE147

CP000489.PE147       Location/Qualifiers
FT   CDS_pept        complement(130604..131779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0147"
FT                   /product="conjugation TrbI family protein"
FT                   /note="PFAM: conjugation TrbI family protein; KEGG:
FT                   mes:Meso_0500 conjugation TrbI-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68264"
FT                   /db_xref="GOA:A1AYC0"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="InterPro:IPR042217"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYC0"
FT                   /protein_id="ABL68264.1"
FT                   /translation="MSDREAAAAPMRLRAEPPRVTRLSRKVLAGLGGIAALGIGAALIF
FT                   ALQTRDVERGGEELFSTENRTTADGLAELPRDYSGPVLGPALPGDLGKPILNARNRGEP
FT                   VPAPAPDIASPLEAVPAMDAAEQQRLAEEEAARLSGVFFQGGPRPAGGPDTGAGSAGSA
FT                   SGGSGTMGEPGATSAQDRHAAFLGAAADRITVVPDRVEAPASPYILQAGSVIPAALVTG
FT                   IRSDLPGQIIAQVTQPVYDSPTGSILLIPQGTRIIGEYDADVTFGQRRVLLVWNRLIYP
FT                   DGRSLVLERLPGADASGYAGLEDGVDYHWGELMKVAGLSTLLAVGTELAAGDEEDRLIR
FT                   AIRDGAQDTVNQAGQQIVQRQLQVAPTLTIRPGFPVRILVSRDLVFENAGG"
     atgagcgaca gggaagctgc cgccgcgccg atgcgcctgc gggccgagcc gccgcgcgtc        60
     acccggctgt cgcgcaaggt gctggcgggc ctcggtggga tcgccgcact cggcatcggg       120
     gcggcgctga tctttgccct gcaaacccgc gacgtcgagc gcggcggcga ggagctgttc       180
     tccaccgaga accgtaccac cgccgacggg ctggcggaac tgccgcgcga ctatagcggt       240
     cccgtcctcg gcccggcgct gcccggcgat ctcggcaagc cgatcctcaa cgcccggaac       300
     cgcggcgaac cggtgccggc gccggcaccg gacatcgcct ccccgctcga ggccgtaccg       360
     gccatggacg cggcggagca gcagcgactg gcggaagaag aggccgcgcg gctcagcggc       420
     gtgttctttc agggtgggcc acggcctgcg ggcgggccgg ataccggtgc cgggagtgcc       480
     ggatcggcgt ccggaggatc cggcaccatg ggagaaccgg gagcgacaag cgcgcaggac       540
     cggcacgcgg cgtttctggg cgccgccgcc gaccgcatca cggtggttcc ggatcgcgtc       600
     gaagcaccgg cctcgcccta tatcctgcag gccggatcgg tgatcccggc ggcgctggtc       660
     accggcatcc gctcggacct gcccggccag atcatcgccc aggtcaccca acccgtctat       720
     gacagcccga ccggctcgat cctgctgatc ccgcagggca cccgcatcat cggcgaatac       780
     gatgcggatg tcacattcgg ccagcgccgc gttctccttg tctggaaccg gctgatctat       840
     ccggacggcc gctcgctggt gctggagcgc ctgccgggcg ccgacgcgtc cggctatgcc       900
     gggctcgagg atggcgtcga ttaccactgg ggagagctga tgaaggtcgc agggctctcg       960
     accctgctgg cggtgggcac cgaactcgcc gccggcgacg aggaggaccg gctcatccgc      1020
     gccatccgcg acggcgccca ggacaccgtc aaccaggccg gccagcagat cgtccagcgc      1080
     cagctgcagg tcgcccccac actcaccatc cggccgggat tcccggtcag gattctggtg      1140
     agccgggact tggtcttcga gaacgcagga ggatga                                1176
//

If you have problems or comments...

PBIL Back to PBIL home page