(data stored in ACNUC7421 zone)

EMBL: CP000489.PE15

CP000489.PE15        Location/Qualifiers
FT   CDS_pept        12535..13119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0015"
FT                   /product="glutathione-dependent formaldehyde-activating,
FT                   GFA"
FT                   /note="PFAM: glutathione-dependent formaldehyde-activating,
FT                   GFA; KEGG: sme:SMb20186 glutathione-dependent
FT                   formaldehyde-activating enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68132"
FT                   /db_xref="GOA:A1AXY8"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR014185"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AXY8"
FT                   /protein_id="ABL68132.1"
FT                   /translation="MVDTSGVKIHPAVDNGIKPAQPGFAGGTLHCKCSTNPVRVAVRAQ
FT                   TAHNHVCGCTKCWKPEGAIFSQVAVVGRDALEVLEGAEKLEIVNAEAPIQRHRCRDCGV
FT                   HMYGRIENRDHPFYGLDFVHTELSDEDGWSAPEFAAFVSSIIESGVDPSRMEAIRARLR
FT                   ELGLEPYDALSPPLMDAIATHIAKRSGALAA"
     atggtggata catcgggggt gaagatccac cccgcagtcg acaacggcat caagccggcc        60
     cagcccgggt tcgcgggcgg cacgctgcat tgcaagtgca gcaccaaccc ggtccgggtc       120
     gcggtccggg cgcagaccgc ccacaaccat gtctgcggct gcacgaaatg ctggaagccc       180
     gagggcgcga tcttttcgca ggtggcggtg gtgggccgcg atgcgctcga agtgctggaa       240
     ggcgccgaaa agctcgaaat cgtcaatgcc gaggccccga tccagcgcca tcgctgccgg       300
     gattgcggcg tgcacatgta tggccggatc gagaacaggg accatccctt ctacgggctg       360
     gatttcgtcc ataccgagct ttccgacgag gacggctggt cggcgccgga atttgcggcc       420
     ttcgtcagct cgatcatcga atcgggggtc gatcccagcc gcatggaggc gatccgcgcc       480
     agattgcgcg aactggggct ggagccctat gatgcgcttt cgccgccgct gatggatgcg       540
     atcgccaccc atatcgcgaa acggtccggc gctcttgcgg cctga                       585
//

If you have problems or comments...

PBIL Back to PBIL home page