(data stored in ACNUC7421 zone)

EMBL: CP000489.PE151

CP000489.PE151       Location/Qualifiers
FT   CDS_pept        complement(134793..135080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0151"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mes:Meso_2319 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68268"
FT                   /db_xref="InterPro:IPR027587"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYC4"
FT                   /protein_id="ABL68268.1"
FT                   /translation="MEGKAMVRLIAILFLAIVMTVTLIRMERAGDLPPLPGRQSQSQPE
FT                   DPLREGQRRCQRMGAAAAEDAECLRIWAETRDRFLGRTPAQSAATSSSEE"
     atggagggca aggcgatggt ccggctcatt gccatcctgt tcctggcgat cgtcatgacc        60
     gtgacgctga tccgcatgga acgggccggc gatctgccgc ccctgcccgg tcggcagagt       120
     caatcgcagc cggaagatcc gctgcgcgag gggcagcgcc gctgccagcg gatgggcgcg       180
     gctgcggcgg aagatgccga gtgcctgcgc atctgggccg agacccgcga ccggtttctc       240
     ggccggacgc cggcgcaatc ggccgcaacc tcgagcagcg aggaatag                    288
//

If you have problems or comments...

PBIL Back to PBIL home page