(data stored in ACNUC7421 zone)

EMBL: CP000489.PE157

CP000489.PE157       Location/Qualifiers
FT   CDS_pept        complement(140328..141215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0157"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: nwi:Nwi_0252 transcriptional
FT                   regulatory protein, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68274"
FT                   /db_xref="GOA:A1AYD0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYD0"
FT                   /protein_id="ABL68274.1"
FT                   /translation="MDLRHLRYVVATARNGSFSAAALELEVQQPIVSRRIRELEEELGT
FT                   ALFDRSTAGAKLTPVGEDFADMAGRILDDFQRLTDRTRAAVEGRRGSVALGFYRSLSSG
FT                   SFRFALRRFRESHPDIGLDLLEAPFVELMADLHSGKLDVAVILGDPDRCPVLNTMAIGT
FT                   EHLMVALPEDHPLAEKPFVYWSDLKGERFLISHQDPGPDIRNILIAKLAAPSDGPEIAN
FT                   LHLSRESILSLVGAGEGISLQCECASGLTGLGAVFRPVHDGNGATRIGYIACWHPDNGN
FT                   PALQTFLEALKSGT"
     atggaccttc gccatctccg ctatgtcgtc gccaccgccc gcaacggtag tttcagcgca        60
     gcagcgctgg agttggaggt ccagcagccg atcgtgagcc gacggatccg tgagctcgag       120
     gaggaactcg gcaccgccct gttcgaccgc tccaccgccg gagcgaagct gacgccggtg       180
     ggcgaagatt tcgcggatat ggccgggcgt atcctggacg atttccagcg actgaccgac       240
     cgaacgcggg cggcagtgga gggtcgccgg ggcagtgtcg cactggggtt ctatcgctcg       300
     ctgtcatccg ggagcttccg cttcgccctg cgccggttcc gcgaaagcca tcccgatatc       360
     ggcctcgacc tgctcgaggc gcctttcgtc gaactgatgg ccgatctgca ttccggcaag       420
     ctcgatgtgg cggtcattct cggcgatccg gatcggtgtc cggtattgaa caccatggcg       480
     atcggcaccg agcacctgat ggttgccctg cccgaggatc atccgctggc cgagaagcct       540
     ttcgtctact ggtccgatct taagggagaa cggttcctga tctcacatca ggatcccgga       600
     cccgatatcc gcaatatcct gatcgccaag ctggccgcac catcggacgg gcccgagatc       660
     gccaacctgc atctgagccg cgagagtatc ctcagcctgg tcggcgcagg cgagggcatc       720
     agcctgcaat gcgaatgcgc gagcggcctg accgggctcg gggccgtgtt ccgaccggtg       780
     catgacggca acggcgcaac ccggatcggc tatatcgcct gctggcatcc tgataatggc       840
     aacccggcgc tgcaaacctt tctggaggca ttgaaatcgg gaacgtga                    888
//

If you have problems or comments...

PBIL Back to PBIL home page