(data stored in ACNUC7421 zone)

EMBL: CP000489.PE16

CP000489.PE16        Location/Qualifiers
FT   CDS_pept        13223..14350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0016"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   rsp:RSP_2576 alcohol dehydrogenase class III"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68133"
FT                   /db_xref="GOA:A1AXY9"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014183"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1AXY9"
FT                   /protein_id="ABL68133.1"
FT                   /translation="MRTRAAVALEAGKPLEVMEVNLEGPKAGEVMVEIKATGICHTDEF
FT                   TLSGADPEGLFPSILGHEGAGVVVEVGPGVTSVKPGDHVIPLYTPECRQCASCLSGKTN
FT                   LCTAIRATQGQGLMPDGTSRFSMLDGTPIFHYMGCSTFSNYTVLPEIAVAKVREDAPFD
FT                   KICYIGCGVTTGIGAVINTAKVEIGAKAVVFGLGGIGLNVLQGLRLAGADMIIGVDLND
FT                   DKKPMAEHFGMTHFINPKNCENVVQEIVNLTKTPFDQIGGADYSFDCTGNVKVMRDALE
FT                   CTHRGWGQSIIIGVAPAGAEISTRPFQLVTGRVWKGTAFGGARGRTDVPQIVDWYMDGK
FT                   IEIDPMITHTLSLDDINKGFDLMHAGESIRSVVLY"
     atgagaaccc gtgccgccgt ggcccttgag gctggcaaac cgctggaagt gatggaggtc        60
     aacctggaag gcccgaaggc cggcgaggtg atggtcgaga tcaaggccac cggcatctgc       120
     cacaccgacg aattcaccct gtcgggcgcc gatcccgagg ggctcttccc ctcgatcctg       180
     ggccatgagg gcgcgggcgt cgtggtcgag gtcggcccgg gcgttacctc ggtcaagccg       240
     ggcgatcatg tcatcccgct ctacacgccc gagtgccggc aatgcgcgtc ctgcctgtcg       300
     ggcaagacca acctttgcac cgccattcgc gccacccagg gtcagggcct gatgccggac       360
     ggaaccagcc ggttcagcat gctcgacggc acgccgatct ttcattacat gggctgctcg       420
     accttctcga actacaccgt gctgccggaa atcgcggtgg ccaaggtgcg cgaggacgcg       480
     cccttcgaca agatctgcta tatcggctgc ggcgtcacta ccggcatcgg cgcggtgatc       540
     aacaccgcca aggtggaaat cggcgccaag gcggtggtct tcggcctggg cggcattggg       600
     ctgaacgtgc tgcaggggct gcgcctggcc ggcgcggaca tgatcatcgg cgtcgatctg       660
     aacgacgaca agaagccgat ggccgagcat ttcggcatga cgcatttcat caacccgaag       720
     aattgcgaga acgtggtgca ggagatcgtg aacctgacca agacgccctt cgaccagatc       780
     ggcggcgcgg attacagctt cgactgcacc ggcaacgtca aggtgatgcg cgacgcgctg       840
     gaatgcaccc atcgcggctg gggccagtcg atcatcatcg gcgtggcgcc ggcgggggcc       900
     gagatcagca cccgcccgtt ccagctggtc accggccggg tctggaaggg cacggccttc       960
     ggcggtgccc gcggccgcac cgacgtgccg cagatcgtcg actggtatat ggacggcaag      1020
     atcgagatcg acccgatgat cacccacacc ctgtcgctgg acgacatcaa caagggcttc      1080
     gacctgatgc atgcgggcga atccatccgc tcggtcgtcc tttactga                   1128
//

If you have problems or comments...

PBIL Back to PBIL home page