(data stored in ACNUC7421 zone)

EMBL: CP000489.PE161

CP000489.PE161       Location/Qualifiers
FT   CDS_pept        complement(145138..146280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0161"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   atc:AGR_L_492 nodulation protein NolF"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68278"
FT                   /db_xref="GOA:A1AYD4"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYD4"
FT                   /protein_id="ABL68278.1"
FT                   /translation="MKLWIAALALVAMMGTGFFLAFPLPGSSNGASRVIDAATGAHAGV
FT                   PRQHRAMQLLPREVLRVAPATIAERLTVSGEVRPVQRVILRAQSGGVVAELGAREGEAV
FT                   RAGDMLVRFDTEELAATLALRQSEVEATEARLRFARQALERIERLAERTVATQEQLDQA
FT                   RRESAVLQAQLDGLRAQAGIARAALRDAEIRAPFDGVVASRSVDVGERASAEAELMTLV
FT                   DPTRLEARVLIATRDVPRIAPGQAAELRIDGLEGETIEGSVLRINPVANDGSRFISVHI
FT                   GLDDPDGRLRGGMFATGTILVEERADVLALPATALREDGDGAYVLRLAEGQIERRPVVT
FT                   GAAWSGGRIEIRDGIASGDTILIAPLPGLGEGVLAEVSGG"
     atgaagctct ggatagcagc cctggcgctg gtcgcaatga tggggacagg tttttttctt        60
     gccttccccc ttccgggatc gtccaatggc gcgtctcggg tcatcgacgc cgcgacaggg       120
     gcacatgccg gggtcccgcg gcagcatcgc gcgatgcagc tgctgccgcg cgaggtgctt       180
     cgcgtcgccc ccgcaaccat tgccgaacgt ctgaccgtca gcggcgaggt ccggccggtg       240
     cagcgcgtca tcctgcgcgc tcagtcgggc ggtgtcgtgg ccgagcttgg cgcgcgcgag       300
     ggcgaggcgg tccgggccgg ggatatgctg gtccgcttcg acaccgaaga actcgcggcc       360
     accctggcgc tgcggcaaag cgaggtcgag gcgaccgagg cccggcttcg cttcgcgcgc       420
     caggcgctgg agcggatcga gcgcctggcc gaacgcactg tcgccacgca ggaacagctt       480
     gaccaggcgc ggcgcgaatc cgctgtcctg caggcgcagc tcgacggtct cagggcccag       540
     gccgggatcg cgcgggcggc cttgcgcgat gccgagatcc gcgcgccctt cgacggggtg       600
     gtcgccagcc gcagcgtgga tgtcggggaa cgcgcgagcg ccgaggccga gctgatgacg       660
     ctggtcgatc cgaccagact ggaagcacgg gttctcatcg ccacgcgcga cgtgccccgg       720
     atcgcgcccg gtcaggccgc agaactgcgg atcgacgggc tggaaggcga gacgatcgag       780
     ggctcggtcc tgcgcatcaa tcccgtcgcg aatgacggct cgcgcttcat ctccgtccat       840
     atcgggctgg acgacccgga cgggcggctg cgcggcggga tgttcgcaac cggcacgatc       900
     cttgtcgagg aacgcgccga tgtgctggcc ctgcccgcga ccgcgctgcg cgaggacggg       960
     gacggggcct atgtgctgcg gctcgcggag gggcagatcg agcgccggcc cgtggtgacc      1020
     ggcgccgcct ggagcggcgg acggatcgag atccgcgacg ggatcgcatc gggcgacacc      1080
     atcctcatcg ccccgctccc gggtctcggc gagggcgtgc tggccgaagt ctcggggggc      1140
     tga                                                                    1143
//

If you have problems or comments...

PBIL Back to PBIL home page