(data stored in ACNUC7421 zone)

EMBL: CP000489.PE162

CP000489.PE162       Location/Qualifiers
FT   CDS_pept        complement(146505..147182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0162"
FT                   /product="MltA-interacting MipA family protein"
FT                   /note="PFAM: MltA-interacting MipA family protein; KEGG:
FT                   ccr:CC0351 putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68279"
FT                   /db_xref="InterPro:IPR010583"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYD5"
FT                   /protein_id="ABL68279.1"
FT                   /translation="MAQDRMIFGLGAASAPEYQGSDQQSARAIPLIDIARGPFFMNLRN
FT                   GIGAYPLEYGDFRFGTSIVYIPGFDLPHALGEVSGSAGARLFTDWERGGVNATFGVTRA
FT                   VSGDLEGTLVDASLSYRHNVTPKLTLIPVIGTTWSDSDYTNSYFGVTPAQAAAAGISSF
FT                   SPGGGFKDVSIGLTANYRVTERVNLTASATMSKLLGDAKDSPIVFDDTQAFGFIGVSYR
FT                   FGN"
     atggcccagg atcgcatgat cttcggcctg ggggccgcca gtgccccgga ataccagggc        60
     tcggaccagc agagcgcgcg cgcgatcccg ttgatcgaca ttgcccgcgg gccgttcttc       120
     atgaacctgc gcaacggcat cggcgcctac ccgcttgaat atggcgactt ccggttcgga       180
     accagcatcg tctatattcc gggcttcgac cttccccatg cgctcgggga ggtctcgggc       240
     agcgctggcg cccgcctgtt caccgactgg gagcggggcg gcgtcaatgc caccttcggc       300
     gtgaccaggg ccgtatcggg cgatctcgaa ggcacgcttg tcgatgcgag cctgtcctac       360
     cgccacaatg tcaccccgaa gttgacgctc atccccgtca tcggcaccac ctggtcggac       420
     agcgactaca ccaacagcta tttcggcgtc acgccggccc aggcggcggc ggccggcatc       480
     tcgtccttct cgccgggcgg cgggttcaag gatgtctcga tcggcctgac cgcgaactat       540
     cgggtgaccg agcgcgtgaa cctgacggct tcggccacga tgtcgaagct tcttggcgac       600
     gccaaggaca gcccgatcgt cttcgacgac acccaggcct tcggcttcat cggggtctcg       660
     taccgcttcg gcaactga                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page