(data stored in ACNUC7421 zone)

EMBL: CP000489.PE163

CP000489.PE163       Location/Qualifiers
FT   CDS_pept        147265..147627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68280"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYD6"
FT                   /protein_id="ABL68280.1"
FT                   /translation="MLCSVLRDEFPQGTVSAMMRSGSCLPGRDCSGMPCQLRCVNVSYL
FT                   GDPLSIRFVCASYPRGMVSGSARVTPGSEAMYSHLPAGSFVRRAMMIVLVASPDMLAAA
FT                   SGSEPENLPQGENGDV"
     atgctctgct ccgttcttcg ggatgaattt ccgcaaggga ccgtgtcggc catgatgcgg        60
     tccgggtctt gcctgccggg gcgggattgt tcaggaatgc cctgtcaatt aagatgcgta       120
     aatgtatctt acctgggcga tccattgtca ataagattcg tttgcgcatc ttatccgcgt       180
     ggcatggttt caggatccgc gagagtcacg ccgggatccg aagccatgta ttcgcacctg       240
     ccggctggaa gtttcgttcg gcgcgccatg atgatagtgc tggtcgccag ccctgatatg       300
     cttgcggcgg catcgggctc ggaaccggaa aacctgccgc agggcgagaa tggcgatgtc       360
     tga                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page