(data stored in ACNUC7421 zone)

EMBL: CP000489.PE164

CP000489.PE164       Location/Qualifiers
FT   CDS_pept        147614..148240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0164"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: sco:SCO1193
FT                   TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68281"
FT                   /db_xref="GOA:A1AYD7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYD7"
FT                   /protein_id="ABL68281.1"
FT                   /translation="MAMSETRGDKARRRRGPALEEAILDAAWEELTTHGYEKLTLEAVA
FT                   RRAGTSRPVLSRRWDSLSKLASAAIVRYALHNPTEVPDLGGLREELILLLRQIARRSSP
FT                   KVVRLIYEMRKDLEAAFSSFADIRTQVGVAGYPMQQILDRAVARGEVRPDFVTPRLLRL
FT                   PVDLARHEMMMTFQPLAESDILEIVDDIVLPLWTGGSGTRQRPSA"
     atggcgatgt ctgaaacccg aggtgacaag gcgcggcgca gacgtggccc tgcgctggag        60
     gaggccatac tggatgcggc ctgggaggag ttgacgacac atggctatga aaagctgacg       120
     ctggaagctg tcgcccgtcg cgccgggacc agtcgccccg tcctgagccg gcgctgggat       180
     agcctgtcca agctcgcttc tgccgcgatc gtgagatatg cgctgcacaa tcccacggaa       240
     gttcccgatc tgggcggtct ccgagaggag ctgatcctgc ttttgcgcca gatcgcgcgg       300
     cggtcgtcgc cgaaggtggt gcgcttgatc tacgagatgc ggaaggatct cgaggcggca       360
     ttttccagtt ttgccgacat ccgcacgcag gtcggcgtcg ccggctatcc gatgcagcag       420
     atactggatc gcgccgttgc gcgcggcgag gtccgcccgg acttcgtcac cccgaggctg       480
     ctacgtctgc cggtcgatct tgcgcgccac gagatgatga tgaccttcca gccgcttgca       540
     gagtcggata tccttgaaat cgtggacgat atcgtgttgc cgctctggac cggcggcagc       600
     gggacgcgac agcgacccag cgcctga                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page