(data stored in ACNUC7421 zone)

EMBL: CP000489.PE165

CP000489.PE165       Location/Qualifiers
FT   CDS_pept        complement(148664..149005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0166"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="SMART: regulatory protein, ArsR; KEGG: nwi:Nwi_3123
FT                   transcriptional regulatory protein, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68282"
FT                   /db_xref="GOA:A1AYD8"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYD8"
FT                   /protein_id="ABL68282.1"
FT                   /translation="MEDKQALAAFAALSQETRLRIVRLLGTAGPEGLPAGAIGEAMDGA
FT                   TSSRMSFHLGPLEHAGLVTSRREGRQIIYSVTYQALSDLIAFLMRDCCQGRPEICAPAV
FT                   AALSCSSAI"
     atggaagaca aacaggcgct tgccgccttc gcggcattgt cgcaggaaac acggctgcgg        60
     atcgtcaggc tgctggggac ggcggggccg gagggcctgc cggccggcgc catcggcgag       120
     gcgatggacg gggccacctc ctcgcggatg tcctttcatc tgggccccct ggagcatgcc       180
     gggctggtca cgtcgcggcg cgagggacgg caaatcatct acagcgtcac ctatcaggcg       240
     ctatccgatc tgatcgcctt tctgatgcgc gattgctgcc aggggcggcc cgagatctgc       300
     gccccggccg tcgccgcctt gtcgtgctcc tctgccatct ga                          342
//

If you have problems or comments...

PBIL Back to PBIL home page