(data stored in ACNUC7421 zone)

EMBL: CP000489.PE166

CP000489.PE166       Location/Qualifiers
FT   CDS_pept        149251..150348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0167"
FT                   /product="gentisate 1,2-dioxygenase"
FT                   /EC_number="1.13.11.4"
FT                   /note="PFAM: Cupin 2, conserved barrel domain protein;
FT                   KEGG: mes:Meso_3565 cupin 2, conserved barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68283"
FT                   /db_xref="GOA:A1AYD9"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYD9"
FT                   /protein_id="ABL68283.1"
FT                   /translation="MMQTEAKSNMMMPEETAELRQLYADFEAEHLHPLWTQIDDLMPVV
FT                   PAPKAVPHVWRWSRLFPLAQRSGDLVPVGRGGERRAIGLANPGLGGKAYVTPTLWAAIQ
FT                   YLGPRETAPEHRHAQNAFRFVVEGEGVWTVVNGDPVRMSRGDFLLTPGWHFHGHHNDTD
FT                   QPMAWIDGLDIPFSYQNDVGFFEFGADRVTDYATPRYSRGERLWCHPGLRPLSGLANTV
FT                   SSPIGAYRWEHTDRALTEQLLLEEEGQPATVGQGHAAVRYINPTTGGDVMPTIRAEFHR
FT                   LRPGVQTAGRREVGSSVFQVFEGQGAVVLNGTEHRLEKGDMFVVPSWVKWLLQAETGFD
FT                   LFRFSDAPIIERLHFARSQVDEADR"
     atgatgcaga ccgaagcgaa aagcaatatg atgatgcccg aggaaacggc cgagctgcgc        60
     cagctctatg ccgatttcga agccgagcac ctccacccgc tctggaccca gatcgacgac       120
     ctgatgccgg tggtgcccgc gcccaaggcg gtgccgcatg tctggcgctg gtcgcggctg       180
     tttccgctgg cgcagcggtc gggggacctg gtgccggtgg ggcggggggg tgaacgccgc       240
     gccatcgggc tggccaatcc cggccttggc ggcaaggcct atgtcacccc cacgctctgg       300
     gccgcgatcc agtatctggg cccgcgcgag accgcgcccg aacaccgcca cgcccagaac       360
     gcctttcgct tcgtggtcga gggcgagggg gtctggaccg tcgtgaacgg cgatccggtg       420
     cggatgagcc ggggcgattt cctgctgacg ccgggctggc atttccacgg ccaccacaat       480
     gacaccgacc agccgatggc ctggatcgac gggctggaca tcccgttttc ctatcagaac       540
     gacgtgggct tcttcgagtt cggcgccgac cgcgtgaccg attacgccac gccgcgctat       600
     tcgcggggcg agcggctgtg gtgccatccc ggcctgcgcc cgctgtcggg cctggccaac       660
     accgtgtcct cgcccatcgg ggcctatcgc tgggaacata ccgaccgcgc cctgaccgaa       720
     cagctgctgc tggaggagga gggccagccc gcaaccgtcg ggcaggggca cgccgccgtg       780
     cgttatatca acccgaccac cggcggcgat gtcatgccca ccatccgggc cgagttccac       840
     cggctgcggc ccggcgtcca gacggcgggg cggcgcgagg tgggatcctc ggtcttccag       900
     gtcttcgagg ggcagggcgc ggtcgtcctg aacggcaccg agcaccgact ggaaaagggc       960
     gacatgttcg tcgtgccgtc ctgggtcaag tggttgctgc aggccgaaac cggcttcgac      1020
     ctgttccgct tttccgatgc cccgatcatc gagcggctgc atttcgcgcg cagccaggtg      1080
     gacgaggctg atcgctga                                                    1098
//

If you have problems or comments...

PBIL Back to PBIL home page