(data stored in ACNUC7421 zone)

EMBL: CP000489.PE168

CP000489.PE168       Location/Qualifiers
FT   CDS_pept        complement(151137..151964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0169"
FT                   /product="regulatory protein, IclR"
FT                   /note="PFAM: regulatory proteins, IclR; KEGG: dar:Daro_0384
FT                   regulatory proteins, IclR"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68285"
FT                   /db_xref="GOA:A1AYE1"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYE1"
FT                   /protein_id="ABL68285.1"
FT                   /translation="MQDESEGGANARGGIQALDAALVVLRGLAEFDGPVALADLARAVS
FT                   MPPSKVHRYLASFIHAGFVKQATRSGRYELGPTSASLGIAALSRSDFVNQAADALPELT
FT                   EATGMTTLISVWGTQGATVIRWCRAPSPMVTSFGLGSNMPLLTSASGRVFLSWLPRPVI
FT                   SARLGLEIERAIEAGLSWPDLDLSMDSIEHLIDRIRADGFATIDGRYVPGLRAMAVPIT
FT                   NWQGEAEAAVTMISTSEQILSADHPAARHLLDFAARHSSQRNWAETTARRTGG"
     atgcaggatg aaagcgaagg cggcgcgaat gcgcgcggcg gcatccaggc gctggacgcg        60
     gcgcttgtgg tcttgcgcgg gctggccgaa ttcgacgggc cggtggcgct ggccgacctg       120
     gcgcgcgcgg tgtcgatgcc gcccagcaag gtccaccgct atcttgccag cttcatccat       180
     gcgggcttcg tcaagcaggc cacacggtct ggccgctacg agcttggccc cacctcggcc       240
     tccctgggca tcgccgcgct gagccgcagc gacttcgtca accaggcggc ggatgcgctg       300
     cccgaactga ccgaggcgac ggggatgacg acgctgatca gcgtctgggg cacgcagggc       360
     gccacggtga tccgctggtg ccgcgcgccc agcccgatgg tcacgtcctt cggcctgggc       420
     agcaacatgc cgctcttgac ctcggccagc ggcagggtct tcctgtcctg gctgccgcgc       480
     ccggtcatct cggcccgcct ggggctggag atcgagcgcg ccatcgaggc cggtctgtcc       540
     tggccggacc tggatctcag catggacagc atcgagcatc tgatcgacag gatccgcgcc       600
     gatggcttcg cgaccatcga cgggcgctat gttccgggcc tgcgtgccat ggccgtgccg       660
     atcaccaact ggcagggcga agccgaggcg gcggtcacga tgatcagcac gtcggaacag       720
     atcctgtcgg ccgaccatcc cgcagcgcgt cacctgctgg acttcgccgc ccgccattca       780
     agccagcgga actgggccga aacgacggcc cgcaggaccg gcggctag                    828
//

If you have problems or comments...

PBIL Back to PBIL home page