(data stored in ACNUC7421 zone)

EMBL: CP000489.PE170

CP000489.PE170       Location/Qualifiers
FT   CDS_pept        152463..153608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0171"
FT                   /product="monooxygenase, FAD-binding protein"
FT                   /note="PFAM: monooxygenase, FAD-binding; KEGG: bja:blr0106
FT                   probable monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68287"
FT                   /db_xref="GOA:A1AYE3"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYE3"
FT                   /protein_id="ABL68287.1"
FT                   /translation="MKRIAVLGGGPGGLYFAYLWKSRHPADSVTLFEQNPEGATFGFGV
FT                   VFSDRAMDFLRADDPETADRITEKMETWSDITLVHHGQRVTIDGVGFSAIGRLELILLM
FT                   QERARDAGVDLRFGTVIGSVAELADYDVIVAADGVNSLVRRSFEGDFQTSISYLDEKFA
FT                   WFGTTKRFETLTQTFVTCEHGTFNAHHYRYSPTMSTFIVECDRASWLKAGFDQLGPDEA
FT                   KTRCEEIFAEALDGHGLVANKSNWRNFPWIWNDRWSHRNMVLIGDALHTAHYSIGSGTR
FT                   LALEDVQALVAALEAHPGDPGAAFAEYEATRRPIVEKLVRAAKTSAAWYADFPAHMQLA
FT                   PLDMAYSYITRSGRIDDQRLTAMSPRFMAEYGAARTVPAAG"
     atgaagcgga tcgctgttct tggcggcggg ccagggggtc tgtatttcgc ctatctgtgg        60
     aaatcgcggc atccggccga ttccgtcacc ctgttcgagc agaaccccga aggcgcgacc       120
     ttcggcttcg gcgtggtctt ttccgaccgg gcgatggact tcctgcgcgc cgacgacccc       180
     gagacggcgg accggatcac cgagaagatg gaaacctggt ccgacatcac gctggtccat       240
     cacggccagc gcgtcaccat cgacggggtg ggcttttcgg ccatcggccg gctggagctg       300
     atcctgctga tgcaggagcg ggcgcgcgat gcaggtgtcg atctgcgttt cggcaccgtc       360
     atcggttcgg tcgccgagct ggcggattac gacgtgatcg tggccgccga cggggtgaat       420
     tcgctggtgc ggcggtcctt cgagggcgat ttccagacct cgatttccta cctggacgag       480
     aaattcgcct ggttcggcac caccaagcgg ttcgagacgc tgacccagac cttcgtgacc       540
     tgcgaacatg gcacgttcaa cgcgcatcat tatcgctatt ccccgacgat gagcaccttc       600
     atcgtggaat gcgaccgggc cagctggctg aaggcggggt tcgaccagct gggaccggac       660
     gaggccaaga cccgctgcga ggagatcttc gccgaggcgc tggacggtca cgggctggtc       720
     gccaacaagt cgaactggcg caactttccc tggatctgga acgaccgctg gtcgcatcgc       780
     aatatggtgc tgattggcga cgcgctgcat acggcgcatt attccatcgg ttcgggcact       840
     cgccttgcgc tggaggacgt gcaggcgctg gtcgccgcgc tcgaggcgca tccgggcgat       900
     ccgggcgcgg cattcgccga atacgaggcg acgcgccgtc ccatcgtcga aaagctggtg       960
     cgcgccgcca agaccagcgc ggcatggtat gcggatttcc ccgcccatat gcagctggcg      1020
     ccgctggaca tggcctacag ctatatcacc cggtccggac ggatcgacga tcagcggctg      1080
     acggcgatgt cgccgcgctt catggccgaa tacggcgccg cgcgcaccgt gccggcagcg      1140
     ggttga                                                                 1146
//

If you have problems or comments...

PBIL Back to PBIL home page