(data stored in ACNUC7421 zone)

EMBL: CP000489.PE173

CP000489.PE173       Location/Qualifiers
FT   CDS_pept        156090..156743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0174"
FT                   /product="maleylacetoacetate isomerase"
FT                   /EC_number="5.2.1.2"
FT                   /note="TIGRFAM: maleylacetoacetate isomerase; PFAM:
FT                   Glutathione S-transferase, N-terminal domain; KEGG:
FT                   mlo:mlr1135 maleylacetoacetate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68290"
FT                   /db_xref="GOA:A1AYE6"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR005955"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034330"
FT                   /db_xref="InterPro:IPR034333"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYE6"
FT                   /protein_id="ABL68290.1"
FT                   /translation="MTRPVLHNYYRSSTSYRVRIALALKGVDYDYAALHLRKGDQRSDA
FT                   FLALNPQGLVPALEWGDGQILTQSLAIIEYLDEIIPQPPLLPSDPAGRARVRSLADMIA
FT                   LDIHPINNLRVLAYLKNHFGADDEATAEWFRHWVSEGFAALEARLARDPQTGTFCHGDR
FT                   VGLADICLAAQITNNARFGVDMTPWPTIRRIGEALAGIEAFRQAAPDRQPDNET"
     atgacgcgcc cggtcctgca caattactat cgcagctcga cttcctaccg ggtgcggatc        60
     gcgctggcgc tgaagggtgt ggactatgat tacgcggctt tgcacctgcg caagggcgac       120
     cagcgatccg acgccttcct ggcgctgaac ccgcaggggc tggtcccggc gctggaatgg       180
     ggcgacgggc agatactgac ccagtccctg gcgatcatcg aatacctgga cgagatcatc       240
     ccccagccgc cgcttctgcc ctcggacccg gcggggcgtg cacgggtgcg cagcctggcg       300
     gacatgatcg cgctggacat ccacccgatc aacaatttgc gggtgctggc ctatctgaaa       360
     aatcatttcg gcgccgatga cgaggccacc gccgagtggt tccgccattg ggtgtccgag       420
     ggctttgccg cgttggaggc gcggctggcc cgagatccgc agaccggcac cttctgccac       480
     ggcgaccgcg tggggctggc cgatatctgc cttgccgccc agatcaccaa caatgcgcgc       540
     tttggggtgg acatgacgcc ctggcccacg atccgcagga tcggcgaggc gctggccggg       600
     atcgaggcat tccggcaggc cgcgcccgac cggcagccgg acaacgaaac ctga             654
//

If you have problems or comments...

PBIL Back to PBIL home page