(data stored in ACNUC7421 zone)

EMBL: CP000489.PE175

CP000489.PE175       Location/Qualifiers
FT   CDS_pept        157992..158912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0176"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family"
FT                   /note="PFAM: inner-membrane translocator; KEGG: bja:blr1064
FT                   ABC transporter permease protein; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68292"
FT                   /db_xref="GOA:A1AYE8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYE8"
FT                   /protein_id="ABL68292.1"
FT                   /translation="MDTVLFVNQLLNGIQLGLILFLLAAGLSLVFGIMDFINLAHGVFY
FT                   MLGAYICATVAIASGSFILGFVVALPAVLVLGLATEWLIVRHFYKRDHLDQVLVTFGLV
FT                   LCADTAVKYLWGPQGLSVPLPAWLGGQVALGGITLPAYRLFIVAVAAVVALALWQVIAR
FT                   TRVGMMVRASASNEEMARALGIETRMIFALVFAIGAVLAGIGGIMVAPITGASIGMGNQ
FT                   IVILALVVIIIGGIGSIFGAFVAAIGVGLIDTLGRAYLPSILGAVFSPSVASSAGPALA
FT                   SILIYLTMTLVLVFRPSGLFPPANR"
     gtggacacgg tattgttcgt caaccagttg ctgaacggca tccagcttgg gctgattctg        60
     ttcctgctgg cggcaggtct gtcgctggta ttcggcatca tggatttcat caacctggcc       120
     catggcgtgt tctacatgct tggcgcctat atctgcgcca ccgtcgccat cgcctcgggg       180
     tcgttcatcc tgggcttcgt ggtggcgctg ccggcggttc tggtgctggg gcttgccacc       240
     gaatggctga tcgtgcggca tttctacaag cgcgatcacc tggaccaggt gcttgtaacc       300
     ttcgggctgg tgctgtgcgc cgacacggcg gtgaaatacc tgtgggggcc gcagggcctt       360
     tcggtgcctt tgccggcatg gctgggcggc caggtcgccc tgggcggcat caccctgccg       420
     gcctatcggc tgttcatcgt cgcggtggcg gcggtggtgg cgttggcgct gtggcaggtg       480
     atcgcgcgca cgcgggtcgg catgatggtg cgcgcctcgg cctcgaacga ggagatggcc       540
     cgcgccctgg gcatcgagac gcggatgatc tttgcgctgg tcttcgccat cggcgcggtg       600
     ctggccggca tcggcgggat catggtggcg ccgatcaccg gggcctcgat cgggatgggc       660
     aaccagatcg tcatcctggc gctggtggtc atcatcatcg gcggcatcgg ctcgatcttc       720
     ggggccttcg tcgcggcgat cggggtgggg ctgatcgaca cgctggggcg ggcctatctg       780
     ccctcgatcc tgggggcggt cttctcgccc tcggtcgcct cgtctgcggg gccggcgctg       840
     gcctcgatcc tgatctatct gaccatgacg ctggttctgg tcttccgccc gtccgggctt       900
     ttcccgccag cgaacaggtg a                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page