(data stored in ACNUC7421 zone)

EMBL: CP000489.PE177

CP000489.PE177       Location/Qualifiers
FT   CDS_pept        159915..160664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0178"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bja:blr1066 ABC transporter ATP-binding protein; TC
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68294"
FT                   /db_xref="GOA:A1AYF0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYF0"
FT                   /protein_id="ABL68294.1"
FT                   /translation="MTPALQVNRLNKYFGGLHATRDVSMTLPRGELHAVIGPNGAGKTT
FT                   LISQLFGELRPSSGQVLIEGRDVTHRPTHERAGLGMARSFQITTLVRDLTVAENVILAL
FT                   LARQGHAGRFWRRVDRNAGLQADAAGALARIGMPATQLGRRVSDLSHGEQRMLELAIAM
FT                   VGDPTLILLDEPMAGLGSEESRAMTRFLAQLKGKTTVLLVEHDMEAVFELADRLTVLVR
FT                   GEVVAVGTPAQIRDDERVRDAYLGEDA"
     atgaccccgg cactgcaagt caatcgcctg aacaagtatt tcggcggcct gcacgcgacg        60
     cgcgacgtgt cgatgaccct gcccaggggc gagctgcacg ccgtcatcgg cccgaacggc       120
     gcgggcaaga cgacgctgat cagccagctt ttcggagagc tgcggccctc gtcgggccag       180
     gtgctgatcg aggggcggga cgtgacccat cggcccacgc atgaacgcgc ggggctgggg       240
     atggcgcggt cgtttcagat caccacgctg gtgcgcgacc tgacggtggc cgagaacgtg       300
     atcctggcgc tcttggcgcg gcagggccat gccgggcggt tctggcggcg ggtggaccgc       360
     aatgcggggc ttcaggccga tgcggccggc gcgctggccc ggatcgggat gccggcgacg       420
     cagcttggcc ggcgcgtctc cgatctcagc catggcgaac agcggatgct ggagctggcc       480
     atcgcgatgg tgggcgatcc gacgctgatc ctgctggacg agccgatggc gggcctgggt       540
     tccgaggaaa gccgggcgat gacccggttc ctggcgcagc tgaagggcaa gaccacggtg       600
     ctgctggtcg agcacgacat ggaggcggtg ttcgagctgg ccgaccggct gaccgtgctg       660
     gtgcgcggcg aggtggtggc ggtcggcacg cccgcccaga tccgcgacga tgaacgggtg       720
     cgcgacgcct atctggggga ggatgcctga                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page