(data stored in ACNUC7421 zone)

EMBL: CP000489.PE183

CP000489.PE183       Location/Qualifiers
FT   CDS_pept        complement(167506..168204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0184"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: oih:OB0952 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68300"
FT                   /db_xref="GOA:A1AYF6"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYF6"
FT                   /protein_id="ABL68300.1"
FT                   /translation="MTDQTMEGFYKSRFIPRAHRIGRLSLLIAMVLCMMPALYLSFVLD
FT                   AFPGIGPILTGFLAIAAFVGIIWVVEPISYFPVLGVCGTYMSFLSGNIGNMRMPVVISC
FT                   QSAVEAEAGSRKAEVAAVIGIAVSVLVNLVFLVALVLIGAALIEVLPPAVAEAIKSYTL
FT                   PALYGAVLVMFMNSATRRNALTGILAGLAVFLSPIPSLFGSAAAGILAIIVAVALNWGK
FT                   RTPEAGKNPA"
     atgaccgacc aaaccatgga aggcttctac aaaagccgct tcatcccccg cgcccatcgc        60
     atcggccgcc tgtcgctgtt gatcgcgatg gtgctgtgca tgatgcccgc gctctacctg       120
     tccttcgtcc tggatgcctt tcccggcatc ggcccgatcc tgaccggctt tctggcgatc       180
     gccgcctttg tcggcatcat ctgggtggtc gagccgatct cctacttccc ggtcctgggc       240
     gtctgcggca cttatatgag ctttctgtcc ggcaatatcg gcaacatgcg gatgccggtg       300
     gtgatctcgt gccagagcgc ggtggaggcc gaggccggca gccgcaaggc cgaggtggcg       360
     gcggtgatcg gcatcgcggt gtcggtgctg gtgaacctgg tcttcctggt cgcgctggtg       420
     ctgatcggcg ccgcgctgat cgaggtcctg ccccccgccg tcgccgaggc gatcaagagc       480
     tataccctgc ccgcgctcta tggtgcggtg ctggtgatgt tcatgaacag cgccacccgc       540
     cgcaacgcgc tgaccggcat cctggcgggg ctggcggtgt tcctgtcgcc catcccgtcg       600
     ctcttcggct cggccgccgc cggcatcctg gcgatcatcg tggcggtggc gctgaactgg       660
     ggcaagcgga cccccgaggc tggcaagaac cccgcctga                              699
//

If you have problems or comments...

PBIL Back to PBIL home page