(data stored in ACNUC7421 zone)

EMBL: CP000489.PE184

CP000489.PE184       Location/Qualifiers
FT   CDS_pept        complement(168231..168968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0185"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: oih:OB0951 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68301"
FT                   /db_xref="GOA:A1AYF7"
FT                   /db_xref="InterPro:IPR032479"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYF7"
FT                   /protein_id="ABL68301.1"
FT                   /translation="MENVLQIANGPVLWLFAILVISVVVAQALMYLRMTLIFSNRYEIL
FT                   TPEERTRIYKTAAINSIGPAVAIFFVAVSLVAMVGSPVTLMRVGVIGSAVFEFVAADQG
FT                   ARAVGAELGRDSYTLQAFAASVWVMTLGGMGWLLSTFFLTKGLDRTQDRMALSNPALIR
FT                   AVGTATPIAIFFLLGANAAVSKSWLSNITIAADNLAAVVTSAGCMVALHAAGKHRPWLR
FT                   EWAVGLSLIAGIAVGFGVGRILA"
     atggaaaacg ttcttcagat cgccaatggc ccggtattgt ggctgttcgc catcctcgtc        60
     atcagcgtcg tcgtcgcgca ggcgctgatg tatctgcgca tgacgctgat tttctcgaac       120
     cgctatgaaa tcctgacacc ggaggagcgg acgcggatct acaagaccgc cgcgatcaac       180
     tcgatcgggc cggcggtagc gatcttcttc gtcgccgtgt cgctggtcgc gatggtcgga       240
     tcgccggtga cgctgatgcg cgtgggggtg atcggctcgg cggtgttcga attcgtggcc       300
     gccgatcagg gcgcaagggc cgtcggcgcc gaactggggc gcgacagcta tacgttgcag       360
     gcgtttgcgg cctcggtctg ggtgatgacg cttggcggca tgggctggct gctttcgacc       420
     ttcttcctga ccaaggggct tgaccggacg caggaccgga tggctctcag caacccggcg       480
     ctgatccgcg ccgtcggcac cgccacgccc atcgcgatct tcttcctgct gggcgccaat       540
     gccgcggtca gcaagtcctg gctgagcaat atcaccatcg ccgccgacaa cctggccgcc       600
     gtcgtcacca gcgcgggctg catggtggcg ctgcatgcgg cgggcaagca ccgtccctgg       660
     ctgcgcgaat gggccgtggg cctcagcctg atcgcgggga tcgcggtcgg cttcggtgtc       720
     ggccgaatcc tggcctga                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page