(data stored in ACNUC7421 zone)

EMBL: CP000489.PE188

CP000489.PE188       Location/Qualifiers
FT   CDS_pept        complement(171675..173552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0189"
FT                   /product="TRAP C4-dicarboxylate transport system permease
FT                   DctM subunit"
FT                   /note="PFAM: TRAP C4-dicarboxylate transport system
FT                   permease DctM subunit; KEGG: rpe:RPE_1982 TRAP
FT                   C4-dicarboxylate transport system permease DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68305"
FT                   /db_xref="GOA:A1AYG1"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYG1"
FT                   /protein_id="ABL68305.1"
FT                   /translation="MFELLASNLAPIMFLSLIGILLLGYPVAFSLAANGLLFFFVAVEL
FT                   SPYAPGTIALSWNLLVALPDRVFSIMSNEVLLAVPFFTFMGIVLQRSGMAEDLLETFGQ
FT                   FFGSVRGGVAYAVVFVGTLLAATTGVVAASVIAMGMISLPVMMRYGYDRRVASGTIMAS
FT                   GTLAQILPPSTILIVLADQLGTSVGDMYTVAFLPSLMLTLSFMLFILLVSIFRPSYVPA
FT                   LPPEALLYREPNGTRGVWQVLALFVVSGIIASLTVRASGMEKTIDVVIFTLCGLSIAAL
FT                   VIALMSRLLGRAALVAGGVLALGFAALAMTRDAGSLAATLAWAASAVCAYVALHGASAR
FT                   GARTRLISAIAERVAFVLVPPVLLIFLVLGTIFIGLATPVEAGAMGAVGSVVLALAKRL
FT                   ADRRPDRLNLAMMTQATYSTAKLCAFILFILIGARVFALTFFGINGHLWVEHLLTGLPG
FT                   GQRGFMIFTVVVIFVLGCFLDFFEIAFIAIPLLLVPAITLGVDPLWLGLVIAITLQTSF
FT                   LTPPLGFSLFFLRSIAPKAAYKDEISGKMIDGVSTRQIYLGGIPFVIIQLLLVIVVLFA
FT                   PEIFMGVGGQAPVMDMEDAMRTLEGFTIDIDPTGGIAVPQIDLTFPSGN"
     atgttcgaac tgcttgcctc caacctcgcc ccgatcatgt tcctgtcgct gatcgggata        60
     ctgcttctgg gctatccggt cgccttctcg ctggccgcga acgggctctt gttcttcttc       120
     gtggcggtcg aactgtcacc ctatgcgccc ggcaccatcg cgctaagctg gaacctgctc       180
     gtggcgctgc ctgaccgcgt gttcagcatc atgtcgaacg aggtgctgct ggcggttccg       240
     ttcttcacct tcatggggat cgtactgcaa cgctcgggca tggccgagga tctgctggaa       300
     accttcggcc agttcttcgg atcggtgcgc gggggcgtcg cctatgcggt ggtgttcgtc       360
     ggcacgctgc tggcggcgac caccggcgtc gtggccgcat cggtcatcgc catgggcatg       420
     atctcgctgc cggtgatgat gcgctatggc tatgaccggc gggtcgcgtc ggggacgatc       480
     atggcctcgg ggacgctggc acagatcctg ccgccctcga ccatcctgat cgtgctggcc       540
     gaccagctgg gcacctcggt cggcgacatg tacacggtgg ccttcctgcc ctcgctgatg       600
     ctgacgctca gcttcatgct gttcatcctg ctggtcagca tcttccgtcc gtcctatgtt       660
     cccgccctgc cgcccgaggc gctgctctat cgcgaaccga acggcacgcg gggcgtctgg       720
     caggtgctgg cgctgttcgt cgtctcgggg atcatcgcct cgctgacggt gcgtgcgtcg       780
     gggatggaga agaccatcga cgtggtgatc tttaccctgt gcggcctgtc catcgcggcg       840
     ctggtcatcg cgctgatgtc gcggctgctg gggcgcgcgg cgctggtggc gggcggcgtg       900
     cttgcccttg gcttcgccgc gctggcgatg acccgcgatg caggctcgct ggcggccacg       960
     ctggcctggg cggccagcgc cgtctgcgcc tatgtcgcgc tgcacggcgc ctcggcacgc      1020
     ggcgcgcgca cccgcctcat ctcggcgatc gccgagcggg tcgccttcgt cctggtcccg      1080
     cccgtgctgc tgatcttcct ggtgctgggg acgatcttca tcggcctggc cacgccggtc      1140
     gaggccgggg cgatgggcgc ggtgggatcg gtggtcctgg ccctggccaa gcggctggcc      1200
     gaccggcggc ccgaccggct gaaccttgcg atgatgaccc aggcgaccta ttccacggcc      1260
     aagctctgcg ccttcatcct gttcatcctg atcggggcgc gggtcttcgc gctgaccttc      1320
     ttcgggatca acggccatct ctgggtcgaa caccttctga ccgggcttcc cggcggccag      1380
     cgcgggttca tgatcttcac cgtcgtggtg atcttcgtcc tgggatgttt cctcgacttc      1440
     ttcgagatcg ccttcatcgc catcccgctt ctgctggtcc cggcgatcac cctgggggtc      1500
     gatccgctgt ggttgggcct ggtgatcgcg atcacgctgc aaacctcgtt cctgacgccg      1560
     ccgcttggct tttcactgtt cttcctgcgc tcgatcgcgc ccaaggccgc ctacaaggac      1620
     gagatcagcg gcaagatgat cgacggcgtg tccacccggc agatctatct gggcggcata      1680
     cctttcgtca tcatccagtt gctgctggtg atcgtcgtgc tgttcgcgcc cgagatcttc      1740
     atgggcgtgg gcgggcaagc cccggtcatg gacatggagg acgcgatgcg cacgctcgag      1800
     ggctttacca tcgacatcga cccgacggga ggtatagctg tgccccagat cgacctgacc      1860
     ttccccagcg gaaactga                                                    1878
//

If you have problems or comments...

PBIL Back to PBIL home page