(data stored in ACNUC7421 zone)

EMBL: CP000489.PE189

CP000489.PE189       Location/Qualifiers
FT   CDS_pept        complement(173552..174082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0190"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter, DctQ component"
FT                   /note="PFAM: Tripartite ATP-independent periplasmic
FT                   transporter, DctQ component; KEGG: mlo:mll5171 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68306"
FT                   /db_xref="GOA:A1AYG2"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYG2"
FT                   /protein_id="ABL68306.1"
FT                   /translation="MTNFLLRSSRAIDYLNRGIGKAASWAIVMAILVSALNALSRHLFG
FT                   VTSNAWLELQWYLFGAVFMLCAAWAMQDNEHVRIDVFSSRFSPRTREIVEMAGHLLFLF
FT                   PFVALMLWLSMQFFLKTLASGEMSPNQGGLPLWPAKALIFIGFLQLTLQWLSEVIKTGF
FT                   RLRDLPNTEGEVS"
     atgactaact ttctgcttcg atcaagccgg gcgatcgatt acctcaaccg ggggatcggc        60
     aaggccgcct cttgggcgat cgtgatggcc attctggtct cggcgctcaa tgcgttgtcg       120
     cggcacctgt tcggcgtgac ctcgaatgcc tggctggaac tgcaatggta cctgttcggc       180
     gcggtcttca tgctctgcgc cgcatgggcg atgcaggaca acgagcatgt gcgcatcgac       240
     gtgttctcca gccggttttc cccgcgcacc cgcgagatcg tcgagatggc gggccacctg       300
     ctgttcctgt tccccttcgt cgcgctgatg ctgtggcttt cgatgcaatt cttcctgaag       360
     acgcttgcct cgggcgagat gtcgccgaac cagggcgggc tgcccctgtg gcccgccaag       420
     gcattgatct tcatcggctt cctccagctg accctgcaat ggctttccga ggtcatcaag       480
     accggcttcc ggctgcgtga cctgcccaac accgaaggcg aggtgtcgtg a                531
//

If you have problems or comments...

PBIL Back to PBIL home page