(data stored in ACNUC7421 zone)

EMBL: CP000489.PE194

CP000489.PE194       Location/Qualifiers
FT   CDS_pept        177720..178925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0195"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: rpa:RPA4557 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68311"
FT                   /db_xref="GOA:A1AYG7"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYG7"
FT                   /protein_id="ABL68311.1"
FT                   /translation="MSFQPLKSIRVLDLTSVVVGPAATWRLGQYGADVVKVENPAGDLM
FT                   RGLGGQSPTGQHSGAYLHLNRGKRNICLDLKSDGARQVIARLIAQADVVVANMRPKALE
FT                   KLGIDPARIQARHPDKIYCLLTGFGTDGPYGGFPAYDSVVQAAAGIPGLSLARDGVPRY
FT                   VPLLICDHVVGEIAAGAILAAVIERQATGRGRMIEIPMFETMAAFVLQEHLAQHSFDPP
FT                   VGPPGDRRLLSPHNMPVQTADGHVAVTINTDAQVRAFLQVTDRAELADDPRFATVAARA
FT                   DNVAEWFEVRGAPLTQRTTAEWLSLFRAADLAAMPCHTLETLPSDPHLAAVGLIEHEDH
FT                   PTEGRTAVIRASLRVDGDSVPTRSPAAPRGWDTRDVLADAGFSASEIETLLSEGSAHEH
FT                   HR"
     atgagctttc agccactgaa atccatccgc gtgctggacc tgaccagcgt tgtggtcggc        60
     cccgccgcga cctggcggct ggggcaatac ggcgccgatg tcgtcaaggt cgaaaacccg       120
     gcgggcgacc tgatgcgcgg cctgggcggg cagtcgccca ccggccagca ttccggcgcc       180
     tatctgcacc tgaaccgggg caagcggaac atctgccttg acctgaaatc cgacggcgcg       240
     cggcaggtga tcgcccgcct gatcgcgcag gccgatgtcg tcgtcgccaa tatgcggccc       300
     aaggcgctgg aaaagctggg catcgacccg gcgaggatcc aggcgcgcca tcccgacaag       360
     atctattgcc tgctgaccgg ctttggcacc gacggaccct atggcggctt tccggcctat       420
     gacagcgtgg tccaggcggc ggcgggcatt cccggcctgt cgcttgcccg cgacggggtg       480
     ccgcgctatg tgccgctgct gatctgcgac catgtggtcg gcgagatcgc cgccggcgcc       540
     atccttgccg ccgtgataga gcggcaggcc accgggcgcg gccgcatgat cgagatcccg       600
     atgttcgaga cgatggccgc cttcgtcctt caggaacatc tggcgcagca cagcttcgac       660
     ccgccggtcg gcccgccggg cgatcgccgc ctgctcagcc cgcacaacat gccggtccag       720
     accgccgatg gccatgtcgc ggtgacgatc aacaccgatg cccaggtgcg cgccttcctg       780
     caggtgacgg accgcgccga actggccgat gatccgcgct ttgcgaccgt cgccgcccgc       840
     gccgacaacg tggccgaatg gttcgaggtc cggggcgcgc ccctgaccca gcggaccacg       900
     gccgagtggc tttcgctgtt ccgcgccgcc gatctggccg ccatgccctg ccacacgctg       960
     gagacgctgc cctcggaccc gcatctggcc gccgtcggcc tgatcgaaca tgaggatcac      1020
     ccgaccgagg gccgcaccgc cgtcatccgc gcctcgttgc gggtggatgg cgacagcgtg      1080
     ccgacccgca gcccggcggc gccccgcgga tgggataccc gcgacgtgct ggccgatgcg      1140
     ggcttttccg cctctgaaat cgaaacgctt ttgtcagaag ggtccgccca tgaacatcac      1200
     cgctga                                                                 1206
//

If you have problems or comments...

PBIL Back to PBIL home page