(data stored in ACNUC7421 zone)

EMBL: CP000489.PE195

CP000489.PE195       Location/Qualifiers
FT   CDS_pept        178909..179730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0196"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   psp:PSPPH_1258 3-oxoacyl-(acyl-carrier-protein) reductase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68312"
FT                   /db_xref="GOA:A1AYG8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYG8"
FT                   /protein_id="ABL68312.1"
FT                   /translation="MNITAETVPAALKGGPRYLDGKVCVIVGVASLRGIGYATAELFAR
FT                   HGAKLVVVDLMMDDTIAADVSQAIATRNGEAPELLGLRCDIGRAADCQGVIDQAVARFG
FT                   RIDCLVNTAAIVKSDGLLAISGDDLDLILNVNLKGAFNLCQNALRVFEEQGSGTIVNIA
FT                   SVAAQRGGGLVGGAHYAASKGGVISLTRSIAREFGPKGIRANAICPSMTETGMLDGNVT
FT                   EAQFAQIVDAIPLKRAGRPEDIANACLYLASDLSAYVTGTTLDVNGGSHIH"
     atgaacatca ccgctgaaac tgtccccgcc gcgctgaagg gcggcccccg ttacctcgat        60
     ggcaaggtct gcgtgatcgt cggcgtcgcc tcgctgcgcg gcatcggcta tgccacggcg       120
     gaactgttcg cccggcacgg cgccaagctg gtcgtcgtcg atctgatgat ggacgacacc       180
     atcgccgccg atgtcagcca ggccatcgcc acccgcaacg gcgaggcgcc cgaactcttg       240
     ggcctgcgct gcgacatcgg ccgcgccgcc gattgccagg gcgtgatcga ccaggccgtg       300
     gcgcgcttcg gccggatcga ttgccttgtg aacaccgccg ccatcgtcaa gtccgacggg       360
     ctgctggcga tctcgggcga cgatctggac ctgatcctga acgtcaacct caagggtgcc       420
     ttcaacctgt gccagaacgc gctgcgcgtc ttcgaagaac agggcagcgg cacgatcgtc       480
     aacatcgcct cggtcgccgc gcagcgcggc ggcgggctgg tgggcggcgc gcattacgcg       540
     gcctcgaaag gcggcgtcat cagcctgacg cgcagcatcg cgcgcgaatt cggccccaag       600
     ggcatccggg cgaacgcgat ctgtccctcg atgaccgaaa ccgggatgct ggacggcaat       660
     gtgaccgagg cgcaattcgc ccagatcgtc gatgccatcc cgctgaaacg cgccggccgg       720
     cccgaggata ttgccaatgc ctgcctgtat ctggcatccg atctttcggc ctatgtcacc       780
     ggcaccacgc tggacgtgaa tggcggcagc catatccact ga                          822
//

If you have problems or comments...

PBIL Back to PBIL home page