(data stored in ACNUC7421 zone)

EMBL: CP000489.PE197

CP000489.PE197       Location/Qualifiers
FT   CDS_pept        complement(181335..182495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0198"
FT                   /product="Butyryl-CoA dehydrogenase"
FT                   /EC_number="1.3.8.1"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   mag:amb2599 acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68314"
FT                   /db_xref="GOA:A1AYH0"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYH0"
FT                   /protein_id="ABL68314.1"
FT                   /translation="MSLDPETLAQFLETLDRFVRERLIPNEERVADGDAIPPELVQEIR
FT                   EMGLFGMSIPEEHGGIGLTMAEEVQAALVLGQASPVFRSLVGTNNGIGSQGIIIDGTPE
FT                   QKAHYLPQLASGEMIASFALTEPDAGSDAGSLRCSARLDGDHYVLNGTKRFITNAPHAG
FT                   LFTVFARTDPDSKSAAGVTAFLVEAGTPGLHLGPRDRKMGQKGSHTCDVILEDCRVPAS
FT                   AIIGGPDRLGQGFKTAMKVLDRGRLHISAVCVGAAERLIRDSLAYAMERRQFGEPIAEK
FT                   QLVQAMLADSRAEAYAARCMIEETARRKDAGLSVSTEAACCKMYASEMVGRVADRAVQI
FT                   HGGAGYMAEYAVERFYRDVRLFRIYEGTTQIQQLVIARNMIREASG"
     atgagcctcg accccgaaac gcttgcgcaa ttcctcgaga ccctggaccg cttcgtgcgc        60
     gaacgcctga tcccgaacga agagcgggtg gccgatggcg acgcgatccc gcccgaactg       120
     gtgcaggaga tccgcgagat gggcctgttc ggcatgtcga tccccgagga acatggcggc       180
     atcggcctga ccatggccga agaggtgcag gccgcgctgg tcctgggcca ggcctcaccg       240
     gtgttccgct cgctggtggg cacgaataac ggcatcggct ctcaggggat catcatcgac       300
     ggcacgcccg agcagaaggc gcattacctg ccacagctgg cctcgggcga gatgatcgcc       360
     tctttcgcgc tgaccgagcc tgatgccggg tcggacgcgg gctcgctgcg ctgttcggcg       420
     cggctggacg gcgatcacta tgtcctgaac gggaccaagc ggttcatcac caacgcgccc       480
     catgccgggc tgttcaccgt cttcgcccgc accgatcccg acagcaagtc ggccgccggc       540
     gtcaccgcct tcctggtcga ggccggcacc cccggcctgc atctggggcc cagggaccgc       600
     aagatgggcc agaagggatc gcatacctgc gatgtcatcc tggaagattg ccgcgtcccg       660
     gcaagtgcga tcatcggcgg ccccgacagg ctgggccagg gcttcaagac cgcgatgaag       720
     gtgctggacc ggggccggct gcacatctcg gcggtctgcg tgggcgcggc ggaacggctg       780
     atccgcgaca gcctggccta tgcgatggag cgcaggcagt tcggcgagcc catcgccgaa       840
     aagcagctgg tgcaggcgat gctggccgac agccgcgccg aggcctatgc cgcccgctgc       900
     atgatcgagg aaaccgcccg gcgcaaggat gccggcctga gcgtctcgac cgaggcggcc       960
     tgctgcaaga tgtatgccag cgagatggtc ggccgcgtgg ccgaccgcgc ggtgcagatc      1020
     catggagggg cgggctacat ggccgaatat gcggtcgaac gcttctatcg cgacgtgcgg      1080
     ctgttccgca tctatgaagg cacgacccag atccagcagc tggtgatcgc ccgcaacatg      1140
     atccgcgagg ccagcggctg a                                                1161
//

If you have problems or comments...

PBIL Back to PBIL home page