(data stored in ACNUC7421 zone)

EMBL: CP000489.PE20

CP000489.PE20        Location/Qualifiers
FT   CDS_pept        16615..18417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0020"
FT                   /product="Pyrrolo-quinoline quinone"
FT                   /note="PFAM: Pyrrolo-quinoline quinone; KEGG: rsp:RSP_2578
FT                   putative pqq dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68137"
FT                   /db_xref="GOA:A1AXZ3"
FT                   /db_xref="InterPro:IPR001479"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017512"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:A1AXZ3"
FT                   /protein_id="ABL68137.1"
FT                   /translation="MKNLMNGACLALLMSGTAALANDSVLAEIAKPQQWAIQMGDYANT
FT                   RYSTLDQINKDNVKDLRVAWTFSTGVLRGHEGSPLVIGDVMYVHTPFPNRVFALDLNDN
FT                   GKILWRYEPQQDPNVIAVMCCDTVYRGLSYADGMILLGQADTTVVALDATSGEVKWSTK
FT                   IGDPGIGETLTATVVPVKDKVLVGISGGEYGVRGRMTALNLTDGSEAWKAWSTGPDEEL
FT                   LVDPETTTHLGKPIGADSSLNSWEGDQWQIGGGTIWGWFSYDPDLNLVYYGTGNPSTWN
FT                   PSQRPGDNKWSMTIMARDADTGMAKWFYQMTPHDEWDYDGVNEMILTNQTVDGQERKLL
FT                   THFDRNGLAYTMDRETGELLVAEKYDPVVNWTTGVDMDPNSETYGRPAVVAEYSTAQNG
FT                   EDENTTGVCPAALGTKDQQPAAFSPKTNLFYVPTNHVCMDYEPFRVAYTAGQPYVGATL
FT                   SMYPAPNSHGGMGNFIAWDNTTGEIKWSVPEQFSVWSGALATAGDVVFYGTLEGYLKAV
FT                   DAQTGEELYKFKTPSGIIGNVMTYEHGGKQYVGILSGVGGWAGIGLAAGLTNPNDGLGA
FT                   VGGYASLSQYTELGGQLTVFELPG"
     atgaaaaacc taatgaatgg cgcctgcctt gcgctgctca tgtccggcac tgcggcgctg        60
     gccaatgaca gcgtgctggc cgagatcgcc aagccccagc aatgggcgat ccagatgggc       120
     gattacgcga acacgcgata ttcgaccctg gaccagatca acaaggacaa cgtcaaggat       180
     ctgcgcgtcg cctggacctt ctcgaccggg gtgctgcgcg gacacgaagg ctcgccgctg       240
     gtgatcggcg atgtcatgta tgtccacacc ccctttccga accgggtgtt tgcgctggac       300
     ctgaacgaca acggcaagat cctgtggcgc tatgaaccgc agcaggatcc gaacgtcatt       360
     gcggtgatgt gctgcgacac ggtctatcgc ggcctttcct atgcggacgg catgatcctg       420
     ctgggccagg ccgacaccac ggtcgtggcc ctggacgcca cgagcggcga ggtgaaatgg       480
     tcgaccaaga tcggcgaccc gggcatcggc gagacgctga ccgccaccgt cgttccggtc       540
     aaggacaagg tcctggtcgg catctcgggc ggcgaatacg gcgtgcgcgg ccggatgacc       600
     gcgctgaacc tcaccgatgg cagcgaggcc tggaaagcct ggtccaccgg cccggacgag       660
     gagttgctgg tcgatcccga aacgaccacg catctgggca agcccatcgg cgccgacagc       720
     tcgctcaaca gctgggaagg cgatcagtgg cagatcggcg gcggcacgat ctggggctgg       780
     ttctcgtatg acccggacct gaacctggtc tattacggca ccggcaaccc ctcgacctgg       840
     aacccctcgc agcggccggg cgacaacaag tggtcgatga cgatcatggc gcgggatgcc       900
     gataccggca tggccaagtg gttctatcag atgacgcccc atgacgaatg ggactatgac       960
     ggcgtcaacg agatgatcct gaccaaccag accgtcgacg ggcaagagcg caagctgctg      1020
     acccatttcg accgcaacgg cctggcctat acgatggatc gcgagaccgg cgagttgctg      1080
     gtggccgaga aatacgatcc ggtggtgaac tggaccaccg gcgtcgacat ggacccgaat      1140
     tcggaaacct atggccgtcc ggccgtggtg gccgaatact cgaccgccca gaacggcgag      1200
     gacgagaaca ccaccggcgt ctgccctgcg gcactgggca ccaaggacca gcagccggcg      1260
     gccttctcgc ccaagaccaa cctgttctat gtgccgacga accacgtctg catggattac      1320
     gagccgttcc gggtggccta taccgccggc cagccctatg tcggcgccac gctgtccatg      1380
     tatcccgcgc cgaacagcca tggcggcatg ggcaacttca tcgcctggga caacaccacg      1440
     ggcgagatca agtggtccgt tcccgagcag ttctcggtct ggtcgggcgc tttggctacg      1500
     gcgggcgacg tggtcttcta cggcacgttg gagggctatc tgaaggccgt cgatgcccag      1560
     acgggcgagg agctttacaa gttcaagacc ccctcgggca tcatcggcaa cgtgatgacc      1620
     tacgaacatg gcggcaagca gtatgtcggc atcctgtcgg gtgtcggcgg ctgggccggg      1680
     atcggccttg ccgcgggcct gaccaatccc aacgatgggc ttggcgcggt gggcggctat      1740
     gcctcgctgt cgcaatatac cgagctgggc ggccagctga ccgtgttcga actgccgggc      1800
     taa                                                                    1803
//

If you have problems or comments...

PBIL Back to PBIL home page