(data stored in ACNUC7421 zone)

EMBL: CP000489.PE202

CP000489.PE202       Location/Qualifiers
FT   CDS_pept        complement(188774..189028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68319"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYH5"
FT                   /protein_id="ABL68319.1"
FT                   /translation="MRPRQSRLHITLTGQADRSVGADVAQGGVQIEQFVGAPDQAFVRA
FT                   ARQSRLKAPTSKTSAPRSPGNWPTSEPASRHETWRTTVP"
     ttgcggcccc gacagagccg tctgcatatt acccttacag gacaggctga ccggtcggtc        60
     ggcgcggatg tcgcacaagg cggcgtccag atcgaacagt tcgtcggtgc cccggatcag       120
     gctttcgtcc gggcagcccg gcagtcacgc ttgaaggccc cgacatcgaa gacctcggcg       180
     ccgcggtcgc ccggcaactg gccgacaagc gagccggcca gcaggcatga gacatggagg       240
     acgacagtgc cctga                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page