(data stored in ACNUC7421 zone)

EMBL: CP000489.PE205

CP000489.PE205       Location/Qualifiers
FT   CDS_pept        complement(191172..191351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0208"
FT                   /product="4-oxalocrotonate tautomerase"
FT                   /note="PFAM: 4-oxalocrotonate tautomerase; KEGG:
FT                   rso:RS05436 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68322"
FT                   /db_xref="GOA:A1AYH8"
FT                   /db_xref="InterPro:IPR004370"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYH8"
FT                   /protein_id="ABL68322.1"
FT                   /translation="MPVVRVSWFEGKAAEEKQKVAQDITDSIVRNTGTDASYIYVIFED
FT                   VKTSDWAGGGKLYG"
     atgcccgtcg tgcgtgtaag ctggttcgaa ggaaaggccg ccgaggaaaa gcagaaggtc        60
     gcccaggaca tcaccgacag catcgttcgc aacaccggca ccgatgcaag ctatatctac       120
     gtcatcttcg aggacgtgaa gacatcggac tgggccggcg gcggcaagct ttacggctga       180
//

If you have problems or comments...

PBIL Back to PBIL home page