(data stored in ACNUC7421 zone)

EMBL: CP000489.PE206

CP000489.PE206       Location/Qualifiers
FT   CDS_pept        191454..192362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0209"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: psb:Psyr_2945 regulatory protein,
FT                   LysR:LysR, substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68323"
FT                   /db_xref="GOA:A1AYH9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYH9"
FT                   /protein_id="ABL68323.1"
FT                   /translation="MMPASHLSGVHAFVETAHHLSFTGAAESLGMTKSAVGKSVSRLEA
FT                   RLGVKLIHRSTRRLVLTQDGEAYLAAARRALEEIEAAEASLSSNHREIAGRLRIDAPAA
FT                   WGRRVLLPILTEVALAQPGLRLSLSLTDRIIDPVAEQVDLVIRFGETADTADLISRKLA
FT                   EQRAPLVAAPAYLARCGVPAQPEDLLRHCCVTGISREMPIGFRIARPGCAPQRLRVAPA
FT                   HEIGDGSAVVEAAIAGLGIAQMPLSLVADALSDGRLVEVLPEFGTVPVGIFALWPRTRH
FT                   LLARVRHVVDLLAAKGQAGAL"
     atgatgccgg caagccatct ctctggcgtg catgcctttg tcgaaacggc ccatcatctc        60
     agcttcaccg gtgcggcgga atcgttggga atgacgaaat ccgccgtcgg caaaagcgtc       120
     agccggcttg aggcccgcct tggcgtcaag ctgatccatc gcagcacgcg gcgcctcgtg       180
     ctgacgcagg atggcgaggc ttatctggcc gccgcccgcc gcgcattgga ggagatcgaa       240
     gccgccgagg cgtcgctgtc cagcaatcac cgagagatcg cgggccggct tcggatcgac       300
     gcgccggccg cctgggggcg ccgggtcttg ctgccgatcc tgaccgaggt ggcgctggcg       360
     cagccggggc tgagattgtc gctgtccttg accgaccgga tcatcgaccc ggtggcagag       420
     caggtcgatc ttgtcatccg cttcggcgaa acggccgaca ccgcagacct gatctctcgc       480
     aagctggccg aacagcgcgc gccgctggtc gctgcgcccg catatcttgc ccggtgcggg       540
     gttccggcgc agcccgaaga cctgctgcgt cactgctgcg tcaccgggat cagccgcgag       600
     atgcccatcg gctttcgcat cgcgcgcccc ggctgcgcgc cgcagcgcct tagggtggca       660
     ccggcgcacg agatcggcga cggatcggcg gtcgtggagg ccgccatcgc ggggttggga       720
     attgcccaga tgccgctctc gctggtcgcg gacgcgctgt cggatggccg attggtcgag       780
     gtgctgcccg aattcggcac cgtgccggtg gggatctttg ccctgtggcc ccggacgcgg       840
     cacctgctgg cgcgcgtgcg gcatgtcgtc gatctgctgg cggccaaggg gcaggcgggc       900
     gcgctgtga                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page