(data stored in ACNUC7421 zone)

EMBL: CP000489.PE209

CP000489.PE209       Location/Qualifiers
FT   CDS_pept        193651..195927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0212"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; cadmium-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; Heavy metal
FT                   transport/detoxification protein; E1-E2 ATPase-associated
FT                   domain protein; KEGG: rsp:RSP_1791 heavy
FT                   metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68326"
FT                   /db_xref="GOA:A1AYI2"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYI2"
FT                   /protein_id="ABL68326.1"
FT                   /translation="MMERPLPAVPAWETRMTDSTTERREWTVSGMDCAACTVKVTRAVE
FT                   RLPGVSDVKVALMGERLSLALADGATAAEEIEKIVRRLGYGIAPREREQPRQAALAPRR
FT                   PHDDGCGGTCGHDRKAASPSGAGHGTPAGGSTPWYRTAKGRLVILTGALLSLAWAFELL
FT                   APAEWGYRAFLLACLIGVAPVAKRAFEALRLGQPFTIESLMTIAATGALFIGAAEEAAL
FT                   VVFLFAVGEVLEGVAAGKARDGIRALANLVPRTAIVEIDGQARETPADSLQIGQVVLVR
FT                   PGDRVPADGEILDGTSGIDESPVTGESVPRTRGPGEPVFAGSINAEAALRVRVTREASD
FT                   NTIARIIRLVEEAEEARAPTERFIDRFSRWYMPAIVGLAALVVVVPPLAFGAEWGTWIY
FT                   RGLALLLIGCPCALVISVPASIASSLSAGARRGMLMKGGAVIEAAARVSHVAFDKTGTL
FT                   THGKPVVTDLIPAPGIGEAALLEVAGGVEAGSSHPLAQAILSRLAQEGVTPLPARAARV
FT                   LVGQGAEAVVGGAPAWVSLPRHAAQRDGIEADALREATRLEGEGKTVVAVFRDGQPLGL
FT                   IAMRDEPRGDAAEAMRQLRDLNVGAIMLTGDNPRTAAAIAGGLGMDYRAEMMPEDKLAA
FT                   IRETGLPGSVMMIGDGINDAPALKQAGIGVAMGSGTDVALETADAAILRDRVTDVPALI
FT                   RLARATMGNIRQNVTIALGLKAVFLVTSVLGITGLWIAILADTGATVLVTLNALRLLRF
FT                   RPEQA"
     atgatggaaa ggccgcttcc tgccgttccg gcatgggaga ccaggatgac cgacagcacc        60
     acggagcggc gcgaatggac ggtaagcggg atggattgtg ccgcatgcac ggtcaaggtg       120
     acgcgggcgg tcgagcggct gcccggcgtc agcgatgtga aggtcgccct gatgggcgag       180
     cggctgtcgc tggcgctggc cgatggcgcg acggccgcgg aagagatcga gaagatcgtc       240
     cgccggctgg gatacggcat tgcccccagg gaacgggaac agccgcggca ggcggccctt       300
     gcgccgcgcc ggccccatga cgacggctgc ggcggcacct gcgggcacga ccgcaaggcc       360
     gcatcgccct ctggcgccgg gcatggaacg cctgccgggg gcagcacgcc atggtatcga       420
     acggcgaagg ggcggctggt catcctgacc ggcgcgctgc tttcgctggc ctgggcgttc       480
     gagctgctgg ccccggcgga atggggttac cgggccttcc tgctggcctg cctgatcggc       540
     gtcgcgccgg tcgcgaaacg cgcgttcgag gcgctgcggc tgggccagcc cttcaccatc       600
     gaaagcctga tgaccatcgc cgcgaccggc gcgctgttca tcggcgcggc cgaggaggcg       660
     gcgctggtcg tgttcctgtt cgcggtgggc gaggtgctgg aaggtgtcgc cgccggcaag       720
     gcgcgcgacg gcatccgggc attggcgaac ctcgtgccca ggacggcgat cgtcgagatc       780
     gacggccagg cccgcgaaac ccccgccgac agcttgcaga tcggtcaggt ggttctggtc       840
     cgccccggcg accgcgttcc tgccgatggc gagatcctgg acggcaccag cggcatcgac       900
     gaaagcccgg tgaccggcga aagcgttccg cgcaccaggg ggccgggcga accggtcttc       960
     gcaggctcga tcaacgccga ggccgcattg cgtgtgcgcg tgacgcgcga ggcatcggac      1020
     aacaccatcg cccgcatcat ccgcctggtc gaggaggcgg aagaggcgcg cgcccccacc      1080
     gaacgcttca tcgaccgctt cagccgctgg tacatgcccg ccatcgtggg tctggcggcg      1140
     ctggtcgtcg tcgtgccgcc gctggctttc ggcgcggaat ggggcacctg gatctatcgc      1200
     gggctggcgc ttctgctgat cggctgcccc tgcgcgctgg tgatctcggt cccggcctcg      1260
     atcgcgtcct cgctgtctgc cggggcaagg cgcggaatgc tgatgaaggg cggcgcggtg      1320
     atcgaggccg ccgccagggt cagccatgtg gctttcgaca agaccggcac gctgacccat      1380
     ggcaagcccg tcgtcaccga tctgatcccg gcccccggca tcggcgaagc cgcattgctg      1440
     gaggtcgcgg gaggggtcga ggcggggtcc agccatccgc tggcgcaggc gatcctgtcg      1500
     cggcttgccc aagagggcgt gacgcccttg cccgcccgcg cggcgcgggt gctggtcggc      1560
     cagggtgccg aggcggtcgt gggcggcgcc cccgcatggg tatccttgcc ccgccacgcg      1620
     gcgcaaaggg acggtatcga ggccgacgcc ctccgcgagg cgacgcggct ggaaggcgag      1680
     ggcaagaccg tcgtcgccgt gttccgcgac gggcagccgc ttggcctgat cgcgatgcgg      1740
     gacgagccgc gcggcgatgc agccgaagcg atgcggcagc tgagggacct gaatgtcggc      1800
     gcgatcatgc tgacgggcga caatccccgc accgccgccg ccatcgcggg cggtctcggg      1860
     atggattatc gggccgagat gatgcccgag gacaagctgg cggcgatccg cgaaaccggc      1920
     ctgccgggta gcgtgatgat gatcggcgac ggcatcaacg acgcgccggc gctgaagcag      1980
     gcggggatcg gcgtcgcgat gggatcgggt accgatgtgg cgctggaaac cgccgatgcg      2040
     gcgatcctgc gcgaccgggt gaccgatgtg cccgcgctga tccggctggc ccgcgcgacg      2100
     atggggaata tccgccagaa cgtcaccatc gcgcttgggt tgaaggcggt gttcctggtg      2160
     acatcggtcc tgggcatcac cgggctgtgg atcgccattc tggccgatac cggcgccacg      2220
     gtgctggtga cgctgaacgc cctgcggctg ctgcgcttcc ggccggagca ggcctga         2277
//

If you have problems or comments...

PBIL Back to PBIL home page