(data stored in ACNUC7421 zone)

EMBL: CP000489.PE213

CP000489.PE213       Location/Qualifiers
FT   CDS_pept        complement(198147..198683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0216"
FT                   /product="protein tyrosine phosphatase"
FT                   /note="PFAM: low molecular weight phosphotyrosine protein
FT                   phosphatase; KEGG: nwi:Nwi_3124 low molecular weight
FT                   phosphotyrosine protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68330"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYI6"
FT                   /protein_id="ABL68330.1"
FT                   /translation="MPDRSRRLFNVLFLCTGNSARSIIAESVLRQDGGGRFRAFSAGSR
FT                   PRGEVHPTARGVLENFHYPTEGLRSKSWDEFAGADAPVMDFVFTVCDQAAGETCPLWPR
FT                   QPISAHWGVPDPAAATGTGLEREMAFIDTLRIMRNRISVFTALPMATLNRASLTARLHQ
FT                   IGQSQGATSARTDMA"
     atgcctgacc gatcccgccg cctgttcaac gtgctgttcc tgtgcaccgg caattcggca        60
     cgctcgatca tcgccgaaag cgtgctgcgc caggatggtg gggggcggtt ccgggccttc       120
     tcggccggca gccggcccag gggcgaggtc catccgactg cgcgcggggt gctggagaat       180
     ttccactatc cgaccgaggg gctgcgctcg aaaagctggg acgagttcgc cggggcggat       240
     gcgccggtga tggatttcgt cttcacggtc tgcgaccagg ccgccggaga aacctgtccg       300
     ctctggcccc gccagccgat ctcggcacat tggggcgtgc ctgatccggc cgcggccacc       360
     ggcacggggc tggaacggga aatggccttc atcgatacgt tgcgcatcat gaggaaccgg       420
     atctcggtct tcacggcgct gccgatggcg accctgaacc gcgcaagcct gacggccaga       480
     ctgcaccaga tcgggcaatc gcagggcgcg acctcggccc ggacggatat ggcctga          537
//

If you have problems or comments...

PBIL Back to PBIL home page