(data stored in ACNUC7421 zone)

EMBL: CP000489.PE217

CP000489.PE217       Location/Qualifiers
FT   CDS_pept        200561..201643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0220"
FT                   /product="luciferase family protein"
FT                   /note="PFAM: luciferase family protein; KEGG: jan:Jann_2939
FT                   luciferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68334"
FT                   /db_xref="GOA:A1AYJ0"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYJ0"
FT                   /protein_id="ABL68334.1"
FT                   /translation="MVKLGTFAMPLHPPHRPVGDIIKENQDKIILADQLGFDIAYMGEH
FT                   YSCTTEQIASPLIFFASLINQTKNIKFATGVIGLPQHHPVIVANEVAMFDHMAQGRFVF
FT                   GIGPGGLASDLEVFDHEDHAVRNEMVAEHLRIVLEIWKSDPPYDIQGKYWNVQIKNAIY
FT                   PELGIGSMSKPYQLPHPPIHISSMSPDSPTVALAARKGWVPITANFTPHETVYGHWKQY
FT                   VAGCEAVGREPTGEDWTVARNIIIGESDAQAEDWMMDPQGSSQYYYDYMWKVLVAADYT
FT                   TVAKPRPDMKDEDITVEQIIRSSVIWGSKETVAEKLNELREKSGPFGTLLMAMTDGSGP
FT                   NLEREQLSMQRLAEIRHLIR"
     atggtcaagc ttggcacctt cgcgatgccg ctgcatccgc cgcatcgccc ggtcggcgac        60
     atcatcaagg aaaaccagga caagatcatc ctggcggacc agttgggctt cgacatcgcc       120
     tatatgggcg aacattattc atgcacgacg gagcagatcg cctcgccgct gatcttcttc       180
     gccagcctga tcaaccagac gaagaacatc aagttcgcca ccggcgtcat cggcctgccg       240
     cagcatcacc cggtcatcgt ggccaatgag gtggcgatgt tcgaccacat ggcgcaaggc       300
     cgtttcgtgt tcggcatcgg gccgggcggc ctggcgtcgg atctcgaggt gttcgatcac       360
     gaagaccatg ccgtccgcaa cgagatggtc gccgaacatc tgcggatcgt tctggaaatc       420
     tggaaatcgg acccgcccta tgacatccag ggcaaatact ggaacgtcca gatcaagaac       480
     gcgatctatc ccgaactggg catcggctcg atgagcaagc cctaccagct gccgcatccg       540
     ccgatccaca tttcctcgat gtcgccggac agcccgacgg tcgcgctggc cgcccgcaag       600
     ggctgggttc cgatcaccgc gaacttcacc ccgcacgaga ccgtctatgg ccactggaaa       660
     cagtatgtcg cgggctgcga ggccgtcggc cgcgagccga ccggagagga ctggaccgtc       720
     gcgcgcaaca tcatcatcgg cgaaagcgac gcccaggccg aggactggat gatggatccg       780
     caggggtcca gccagtatta ctacgactac atgtggaagg tgctggttgc cgcggattac       840
     accaccgtcg ccaagcccag gccggacatg aaggacgagg acatcacggt cgagcagatc       900
     atccgctcct cggtgatctg gggctcgaaa gagaccgtgg ccgagaagct gaacgagctg       960
     cgcgagaagt cggggccgtt cggcaccctg ctgatggcga tgaccgacgg cagcggtccc      1020
     aacctcgagc gcgagcagct gtcgatgcag cgcctcgccg agatccgcca cctgatccgg      1080
     tag                                                                    1083
//

If you have problems or comments...

PBIL Back to PBIL home page