(data stored in ACNUC7421 zone)

EMBL: CP000489.PE218

CP000489.PE218       Location/Qualifiers
FT   CDS_pept        201702..202565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0221"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_C0656 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68335"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYJ1"
FT                   /protein_id="ABL68335.1"
FT                   /translation="MSNATPSAVDMADIFTLSQARRVAAMLDIDPQQLRQGDPVPRGWH
FT                   FAMLAGQSPRHALRPDGFPGLGIPMPRTDRPRLLLGERSMAFRGNLVVGAPLRRQSAIA
FT                   SIVEKTGRNGPLSIVRVEHVLSGDADAPDGAASITESQTYYLAGPPSSPGTATATRPGR
FT                   AAPDVPAAGASKVVTPDEVLLFQYSALGFNTHRIHFDRDYATRVEGHPDLVVNGGLATL
FT                   LATEYLRNDLGKSVSTLSARHLAPLYVNRPLTIRPSELSDTGASLSLIDCDGRVAAELV
FT                   VTFDEL"
     atgtcgaatg cgaccccatc agcggtggac atggctgaca tcttcacgct ttcccaggca        60
     cggcgtgtcg cggcgatgct ggacatagac ccgcagcagc tgcggcaggg cgatccggtc       120
     ccgcgcggct ggcatttcgc catgcttgcc gggcaatccc cccgccacgc cctgcgcccg       180
     gacgggtttc cggggctggg cattccgatg ccccggacgg accgcccgcg cctgctgctt       240
     ggcgaacgca gcatggcctt tcggggcaac cttgtcgtgg gcgcgccgct gcggcggcaa       300
     agcgcgatcg caagcatcgt ggaaaagacc ggacggaacg ggcccctgtc gatcgtcagg       360
     gtcgaacatg tcctgtcggg tgacgcggat gcccctgacg gcgcggcctc gatcacggaa       420
     tcccagacct attacctagc gggcccgccg tcatcgcccg gcaccgcgac cgcgacacgg       480
     ccgggacggg ccgcacccga tgtcccggcc gccggcgcgt ccaaggtcgt caccccggat       540
     gaagtgctgc tgtttcagta ttccgccctg ggcttcaaca cgcatcgcat ccatttcgac       600
     cgggactacg ccacgcgggt cgagggccat cccgacctgg tggtcaatgg cgggctggcc       660
     accctgctgg ccaccgaata tctgcgcaat gacctgggca aatcggtcag cacgctgtcg       720
     gcacgccatc tggcgccgct ttatgtgaac cggcccctga ccatccgccc atccgaattg       780
     agcgatacgg gggcaagcct ctctttgatc gactgcgacg ggcgggtcgc ggcggaactg       840
     gtggtgactt tcgatgagct atga                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page