(data stored in ACNUC7421 zone)

EMBL: CP000489.PE219

CP000489.PE219       Location/Qualifiers
FT   CDS_pept        202555..203775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0222"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: pol:Bpro_5571 L-carnitine dehydratase/bile
FT                   acid-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68336"
FT                   /db_xref="GOA:A1AYJ2"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYJ2"
FT                   /protein_id="ABL68336.1"
FT                   /translation="MSYEPLHGTRVLDLTAVVVGPAATWRLGQYGAQIIKVESPGGDLM
FT                   RGLGGLSPTGQHAGAYLHLNRGKRNICLDLKAPGASGVMERLVAWADVIVANMRPKALA
FT                   RLGLDPETVRAGHPGKIYCLLTGYGSDGPYGGFPTYDSVVQGAVGLPGLALERDGTPGY
FT                   VPLLICDHVVGEIAAGAILAALLNRHRTGKGVTLEVPMFETMATMVLQEHLAAQSFDPP
FT                   AGPYGDQRLLSPHNRPMRTKDGFIAVTINTDPQVRAFLAATGRGHLATDPRFASVAARA
FT                   VHVAEWFEIRGAPLTDRTTDEWLKIFRTADLAAMPVHSIESLSRDPHLTAVQLMTQEDH
FT                   PTEGRTTVLRSSIRADDAPLPPRGPAAPRGWDTRAVLDELGYTGAEAAALLDRGVAVAH
FT                   SSAPDRT"
     atgagctatg aacccctgca cggcacgcgc gtcctggacc tgacggccgt ggtggtcggc        60
     ccggccgcga catggcgcct gggccagtac ggcgcccaga tcatcaaggt cgaaagcccc       120
     ggaggcgacc tgatgcgcgg ccttggcggg ctgtccccga ccggccagca tgccggggcc       180
     tatcttcacc tgaaccgggg caagcgcaac atctgccttg acctcaaggc gccgggcgca       240
     tccggggtga tggagcggct tgtcgcctgg gccgatgtca tcgtcgccaa catgcggccc       300
     aaggcgctgg cccggctggg gctggacccc gaaacggttc gcgccgggca tccgggaaag       360
     atctactgcc tgttgacggg atatgggtcc gacggccctt atggcggctt tcccacctat       420
     gacagcgtgg ttcagggcgc ggtcggtctg cccggtcttg cgctggaacg ggacgggacg       480
     cccggatatg tcccgctgct gatctgcgat cacgtcgtcg gagagatcgc ggccggcgcc       540
     attctggccg ccctgctgaa ccggcaccgc accggcaagg gcgtgacgct ggaagtcccg       600
     atgttcgaga cgatggcgac gatggtgttg caggaacacc tggcggcgca gagcttcgat       660
     ccgcctgccg gcccctatgg cgaccagcgg ctgctcagcc cgcataaccg gccgatgcga       720
     acgaaggacg ggttcatcgc cgtcaccatc aataccgacc cgcaggtcag ggcattcctg       780
     gcggcgacag ggcgcggcca tctggcgacc gatccaagat ttgccagcgt cgcggcacgc       840
     gcggtccatg tcgcggaatg gttcgagatc cgaggcgcgc cgctgaccga caggaccacc       900
     gacgaatggc tgaagatctt tcgcacggcg gaccttgccg ccatgccggt ccattccatc       960
     gagagcctga gccgcgatcc gcatctgacc gccgtgcagc tgatgacgca ggaagaccac      1020
     ccgacagaag gccggacgac ggttctgcgc agctccatcc gcgccgacga cgcccccctg      1080
     ccgccgcgcg gcccggcggc cccgcgcgga tgggataccc gcgccgtcct tgacgagctt      1140
     ggctatacgg gcgccgaggc cgcggcgctt ctggaccggg gggtggccgt tgcgcattca      1200
     tccgcacctg accggacgtg a                                                1221
//

If you have problems or comments...

PBIL Back to PBIL home page