(data stored in ACNUC7421 zone)

EMBL: CP000489.PE222

CP000489.PE222       Location/Qualifiers
FT   CDS_pept        complement(207290..207832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0225"
FT                   /product="flavin reductase domain protein, FMN-binding
FT                   protein"
FT                   /note="PFAM: flavin reductase domain protein, FMN-binding;
FT                   KEGG: rsp:RSP_3957 flavoprotein oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68339"
FT                   /db_xref="GOA:A1AYJ5"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYJ5"
FT                   /protein_id="ABL68339.1"
FT                   /translation="MPSFSFPCLDGDPEFRESLRTALRGTAVNVSILTARDRAGMNHGI
FT                   AVTTAVPFSTYRPAMIVAVKHSASAYPAILDSNYFCLNQIAADEIDLLDRFSRSDRRTS
FT                   RFATGCWSVGPFCLPYLGSALTSYFCDVQGAHDHEDQTVFIGRIVGVRLGNDGTGGRDP
FT                   LMWINGRAARLAGREYV"
     atgccgagct tctcgttccc ctgtcttgac ggcgatccag agtttcgcga gagccttcgc        60
     accgcgctgc gcgggacggc ggtgaacgta tccatcctga cggcaaggga ccgggcgggg       120
     atgaaccatg gcatcgccgt taccacggcg gtgccgttct cgacctatcg gccggcgatg       180
     atcgtggccg tcaagcatag cgcctcggcc tatccggcga tcctggacag caactatttc       240
     tgcctgaacc agatcgccgc cgacgagatc gacctgctgg atcgcttcag cagaagcgat       300
     cgccggacat cgcgcttcgc gacgggctgc tggtcggtgg gaccattctg cctgccctat       360
     ctgggcagcg cgctgacaag ctatttctgc gatgtccagg gcgcgcatga ccacgaggac       420
     cagacagtct ttatcggcag aattgtcggc gttagactgg gaaatgacgg caccggcgga       480
     cgcgatcccc tgatgtggat aaatggacgc gctgcgaggc ttgcgggtcg agaatatgta       540
     tag                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page