(data stored in ACNUC7421 zone)

EMBL: CP000489.PE224

CP000489.PE224       Location/Qualifiers
FT   CDS_pept        complement(209038..209307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0227"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68341"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYJ7"
FT                   /protein_id="ABL68341.1"
FT                   /translation="MQVVLSGSALSPLGWGGVATMEPVDRGELENFAVVAALDRIGYTG
FT                   SLGILGWDYCGDVYSKLDRCLAAMRALDRRLQANPGWAEIVPRP"
     atgcaggtgg tgctgtcggg cagcgcgctt tcgccactgg gctggggcgg ggtcgcgacg        60
     atggagcctg tcgatcgcgg cgagcttgag aatttcgctg tggtcgctgc gctggatcgc       120
     atcggctata ccggcagcct cggcattctc ggctgggact attgcggcga cgtctattcc       180
     aagctggacc gttgccttgc ggcgatgcgc gccctcgacc ggcgccttca ggccaatccg       240
     ggctgggccg agatcgtgcc gcgaccgtaa                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page