(data stored in ACNUC7421 zone)

EMBL: CP000489.PE225

CP000489.PE225       Location/Qualifiers
FT   CDS_pept        complement(209307..209846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0228"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: sus:Acid_5864 xylose isomerase domain protein TIM
FT                   barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68342"
FT                   /db_xref="GOA:A1AYJ8"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYJ8"
FT                   /protein_id="ABL68342.1"
FT                   /translation="MSHPVHALDSFFYTSMGVYAFESQCEMLAELGYDGITVSAWGGQP
FT                   MTDLSLLPTVKERHGLDVAALYAVLHEGRNDAIIRRIIESVEGVELIELAVQTSLNGEA
FT                   AILRNIEALLPIAERRGLRIALYPHLRHVTQTTSEVVRLCEYFDHPLLGASFNGYHWYA
FT                   SRRAGWRNASPRSSPG"
     atgtcccatc ccgtccacgc gctcgattcg ttcttctata cctcgatggg ggtctatgcc        60
     ttcgaatcgc aatgcgaaat gctggccgaa ctcggctatg acggcatcac ggtctcggcc       120
     tggggcggtc agcccatgac cgatctttcg ctgttgccca cggtcaagga acgccacggc       180
     ctggatgtcg ccgcccttta tgccgtgctg cacgaggggc gcaacgacgc catcatccgc       240
     cggatcatcg aatccgtcga gggggtggag ctgatcgaac tggccgtgca gacctcgctg       300
     aacggcgagg ccgccatcct gcgcaacatc gaagcgctgc tgccgatcgc cgagcgtcgc       360
     ggcctgcgga tcgcgctcta tccccatctg cggcatgtca cccagaccac cagcgaggtc       420
     gtccgtctgt gcgagtattt cgaccacccc ctgctgggtg cgtccttcaa cggctatcac       480
     tggtatgcca gcaggagggc aggctggagg aacgcctcgc cgcgatcaag ccctggctga       540
//

If you have problems or comments...

PBIL Back to PBIL home page