(data stored in ACNUC7421 zone)

EMBL: CP000489.PE226

CP000489.PE226       Location/Qualifiers
FT   CDS_pept        complement(209861..210658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0229"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: sus:Acid_5864 xylose isomerase domain protein TIM
FT                   barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68343"
FT                   /db_xref="GOA:A1AYJ9"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYJ9"
FT                   /protein_id="ABL68343.1"
FT                   /translation="MNLPLHHMDFIFQTKLGTYPLAAQCEMLAELGYQGLTVSAWSKEL
FT                   DALASVKPRWGLDVGAIYLIYGRGLEDFVTRIFETAEGCTRIELALDSGDGVTDADLRM
FT                   IERLLPICERRGIDIALYPHGRYGMQTTTEAVALCQRFDHPALGIVFNGYHWYAMQEGS
FT                   LDARLDALWPWLRQVNLAGCRMSPLGWGGLATIEPLDEGEMDNFVLLGALERRGFKGRC
FT                   GVLGWESMGGDVYGNLQRSMTAFRSMEARLAAHPGWAVMTQLT"
     atgaacctgc cgcttcacca catggacttc atcttccaga ccaagctggg gacctatccg        60
     ctggccgccc aatgcgagat gctggccgaa ctcggctatc agggcctcac cgtttcggcc       120
     tggagcaagg agctggacgc gctggcctcg gtgaagccgc gatgggggct ggatgtgggc       180
     gcgatctacc tgatctatgg cagggggctt gaagatttcg tcacccgcat tttcgaaacc       240
     gccgaaggct gcacgcggat cgaactggcg ctggattccg gcgatggcgt cacggatgcc       300
     gacctgcgga tgatcgagcg tctgttgccg atctgcgaac gccggggcat cgacatcgcg       360
     ctgtatccgc acggccgcta cgggatgcag acgaccaccg aggccgttgc cctgtgccag       420
     cgcttcgatc acccggccct gggcatcgtg ttcaatggct atcactggta tgcgatgcag       480
     gaaggatcgc tggatgcgcg tctcgacgcg ctgtggccgt ggctgcggca ggtcaatctt       540
     gccggatgcc gcatgtcgcc cctgggctgg ggcgggctgg ccaccatcga gccgctcgac       600
     gagggcgaga tggacaattt cgtgctgctc ggcgcgctcg agcggcgcgg gttcaaggga       660
     cgctgcggcg tgctgggctg ggaaagcatg ggcggcgatg tctatggcaa tctgcaacgc       720
     tcgatgaccg ccttccgctc gatggaggcg cggctggccg cgcatccggg ctgggccgtc       780
     atgacgcaac tgacctga                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page