(data stored in ACNUC7421 zone)

EMBL: CP000489.PE236

CP000489.PE236       Location/Qualifiers
FT   CDS_pept        complement(219738..221327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0239"
FT                   /product="extracellular solute-binding protein, family 5"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   5; KEGG: pol:Bpro_4344 extracellular solute-binding
FT                   protein, family 5"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68353"
FT                   /db_xref="GOA:A1AYK9"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYK9"
FT                   /protein_id="ABL68353.1"
FT                   /translation="MLINRRRILHMSVAAAAASLAGPGLLRAQGSDRPIRIALAATSPR
FT                   AIDPIFSTLGADNWVNLQVYEHLVSPPNGRFATQDDEYRPMLAESWTKSDDARTWTFKL
FT                   RRDVAFHGGHGTLTPEDVVFTFERAMREGIATASYANVRGVAASGPDEVTFTLNGPDPF
FT                   FLGGVISIPSSLIVCKSAVEEKGENFGKEPVGTGPYAVERMSSSGVNTLRFDGYWGEPP
FT                   KTARIDFLYTSDTTSRTLSLMSGDVDMIEAVRAPGWVQQIRQQNDALIVDQTQPGSFNT
FT                   LFFNLTKAPFDNPLVRKAVATAIDSAVVAQALAPFGAQTWTLSPPDYPSGWAAEDLPED
FT                   LRYDYDPDRARELLAEAGHGNGLNFTASISQREDYRSIMLILQELMRPAGINMNLNIMD
FT                   HAAFHGANRQDANSLVLYSQSLPPVPLEYMSRYLSSAAVVKSDGTGGDNFSHYGIAMPG
FT                   VDDRIEAMRQATTVEEYSSIGREIEKKVQEDLPLMGVGNLGYAIVRNPAVDIGYQVESG
FT                   YARWRLDLAQRA"
     atgctgatca atcgtcgcag aatcctgcac atgtccgtcg cggcggcagc ggcaagcctt        60
     gccggtccgg gactgctgcg cgcgcaggga tcggaccgcc cgatccgcat cgcgcttgcc       120
     gccacatcgc cgcgcgcgat cgacccgatc ttcagcacgc tcggggccga caactgggtc       180
     aacctccaag tctatgagca tctcgtctcg ccgccgaatg gcagattcgc gacccaggac       240
     gacgaatatc gcccgatgct tgccgaaagc tggaccaagt ccgacgatgc ccggacatgg       300
     accttcaagc tgcgcaggga tgtcgcgttc cacggcggcc atggcacgct gacccccgag       360
     gacgtggtgt tcaccttcga acgcgccatg cgtgaaggca tcgccacggc atcctatgcc       420
     aatgtgcggg gcgtcgccgc ctcgggcccc gacgaggtga cgttcacgct gaacgggccg       480
     gatccgtttt tcctgggggg cgtgatctcg atccccagtt cgctgatcgt gtgcaagagc       540
     gcggtcgagg agaagggcga gaatttcggc aaggaacccg tcggcaccgg cccctatgcg       600
     gtcgaacgca tgtcaagcag cggcgtcaat accctgcgct tcgacggcta ttggggcgag       660
     cctccgaaga ccgcgcggat cgacttcctc tatacctcgg atacgacctc gcggacgctt       720
     tcgctgatgt cgggcgacgt ggacatgatc gaggcggtgc gcgcgcccgg atgggtgcag       780
     cagatccggc agcagaacga cgcgctgatc gtcgatcaga cgcagccggg atccttcaac       840
     acccttttct tcaacctgac caaggcaccc ttcgacaatc cgctggtgcg caaggcggtc       900
     gccaccgcga tcgacagcgc ggtggtcgcc caggcgctgg ccccgttcgg cgcacagaca       960
     tggacgctct cgccgcccga ctatccctct ggctgggccg cggaagatct gcccgaggat      1020
     ctgcgctatg attacgatcc cgatcgcgcg cgcgaattgc tggccgaggc cgggcacgga      1080
     aacgggctga acttcaccgc cagcatcagc caacgcgagg attaccgctc gatcatgctg      1140
     atcctgcaag agctgatgcg cccggccggg atcaacatga acctgaacat catggatcac      1200
     gcggccttcc acggcgccaa tcggcaggat gccaactcgc tggtgctgta ttcgcaaagc      1260
     cttcccccgg tgccgctgga atacatgtcg cgctacctgt cctctgcggc ggtggtgaaa      1320
     tccgatggga ccggcggcga caacttcagc cattacggca tcgccatgcc cggcgtggac      1380
     gaccggatcg aggcgatgcg ccaggccacc acggtcgagg aatattcctc gatcggacgc      1440
     gagatcgaga agaaggtgca agaggatctg ccccttatgg gggtcggcaa ccttggctat      1500
     gccatcgtcc gcaatcccgc agtcgatatc ggctaccagg tcgaaagcgg ctatgcgcgc      1560
     tggcgcctgg atctggcgca gcgcgcctga                                       1590
//

If you have problems or comments...

PBIL Back to PBIL home page