(data stored in ACNUC7421 zone)

EMBL: CP000489.PE237

CP000489.PE237       Location/Qualifiers
FT   CDS_pept        complement(221408..222094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0240"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; KEGG: mes:Meso_4461 transcriptional regulator,
FT                   GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68354"
FT                   /db_xref="GOA:A1AYL0"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYL0"
FT                   /protein_id="ABL68354.1"
FT                   /translation="MTSRTKDQPRPKGRSIQRPGRLGDEVYEALYAQLMALEIPPGARI
FT                   SVDNLVRELGVSQTPIREALSRLEAQGLVVKTHLIGYSAASQIDEQRLEQLYDLRLLLE
FT                   PYAAGRAAVHMDDDDIARLVALDARMDEIHPDGKESYGEFAAADGQFHDLIAQGSGNEL
FT                   VRDALSRLYTHVHLFRLFYLASVTAEANDEHAAIVAAIVARDSAAAEEAMRRHVLESRK
FT                   RFTGRR"
     atgacaagtc gcaccaagga tcagccccgg ccgaaagggc gctctatcca gcgccccggc        60
     aggctggggg acgaagtgta cgaggcgctt tatgcgcagc tgatggcgct ggaaattccg       120
     cccggcgcgc gcatttcggt ggacaatctc gttcgagagc ttggcgtgtc gcagaccccg       180
     atccgcgagg cgctgtcgcg gctggaagcg cagggtctgg tggtcaagac ccacctgatc       240
     ggctacagcg ccgcgtccca gatagacgag cagcggctgg agcagcttta tgatctgcgc       300
     ctgctgctgg agccttatgc ggccgggcgc gccgcggtgc atatggatga cgacgacatc       360
     gcccggctgg tcgcgctgga tgcccgcatg gatgaaattc acccggacgg caaggaaagc       420
     tatggcgaat tcgccgcggc ggacgggcag tttcacgacc tgatcgcgca gggcagcggc       480
     aacgagctgg tgcgcgacgc cctgtcccgg ctctacacgc atgtgcatct gttccggctg       540
     ttctaccttg ccagcgtgac cgccgaggcg aatgacgaac atgcggccat cgtcgcggcc       600
     atcgtcgccc gagacagcgc cgccgccgag gaggcgatgc ggcggcatgt cctggaatcg       660
     aggaagcgct tcaccggcag acgttaa                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page