(data stored in ACNUC7421 zone)

EMBL: CP000489.PE246

CP000489.PE246       Location/Qualifiers
FT   CDS_pept        231893..232855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0249"
FT                   /product="monosaccharide ABC transporter membrane protein,
FT                   CUT2 family"
FT                   /note="PFAM: inner-membrane translocator; KEGG: msu:MS0199
FT                   ribose/xylose/arabinose/galactoside ABC-type transport
FT                   systems, permease components; TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68363"
FT                   /db_xref="GOA:A1AYL9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYL9"
FT                   /protein_id="ABL68363.1"
FT                   /translation="MNKTLTASPSRRLPINLRDAGTLFGLVLIFAVFAALNPVFLTGPN
FT                   LINILQQSAINACIALGMTFVIISGGIDLSVGPTAAVSVIVGATLMIAGVPIPLAVVAA
FT                   IATGMACGLFNGTLVAIAGLQPFIVTLGALSLYRALALIFTGGNPIFGIPTEFRQAINS
FT                   LVLGVPVPVIIVAVIAAVLWVVLNRSPLGEYILAVGGNQEAARIAGVPVARTRITVYVL
FT                   SGGLAAVAGLILTGRLGAADPTMGNLWELDAIAAAAIGGASLMGGKGSVIGTLMGAVIL
FT                   GGLRNGLTLMNVQAFYQLLATGIIILVAMLIDRATRGKA"
     atgaacaaga ccctgaccgc atctccgagc cgccggttgc cgatcaacct ccgcgacgcc        60
     ggcacccttt tcggcctcgt gctgatcttc gccgtattcg cggcgctgaa cccggtcttt       120
     ctgaccgggc cgaacctgat caacattctc cagcaatccg cgatcaacgc ctgcatcgcc       180
     ctggggatga ctttcgtgat catctcgggc gggatcgatc tgtcggtcgg accaacggct       240
     gcggtatcgg tgatcgttgg cgcgaccctg atgatcgccg gcgtgccgat cccgctggcc       300
     gtcgtcgccg cgatcgcgac cggcatggcc tgcgggctgt tcaacggtac gctggtggcc       360
     atcgcggggc tgcaaccctt catcgtgacg cttggcgccc tgtcgctcta tcgggcgctg       420
     gcgctgatct tcaccggcgg caacccgata ttcggcatcc cgaccgagtt tcggcaggcg       480
     atcaacagcc tggtcctcgg cgtgcccgtg ccggtcatca tcgtcgcagt gatcgcggcg       540
     gtgttgtggg tggtgctgaa ccgcagcccg cttggagaat atatcctggc cgtcggcggc       600
     aatcaggagg cagcgcgtat cgccggggtg ccggtggcac gcacacggat caccgtctat       660
     gtgctttcgg gcgggctggc cgccgtggcc gggctgatcc tgaccggacg gctgggcgca       720
     gccgacccga ccatgggcaa cctgtgggaa ctggacgcca ttgccgcggc cgccatcggc       780
     ggggcctccc tgatgggcgg caagggctcg gtcatcggca cgctgatggg cgcggtgatc       840
     ctggggggct tgcgaaacgg cttgacgctg atgaatgtgc aggccttcta tcaactcctt       900
     gcgacgggta tcatcattct cgtggcaatg ttgatcgacc gggcaacgcg gggcaaggca       960
     tga                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page