(data stored in ACNUC7421 zone)

EMBL: CP000489.PE247

CP000489.PE247       Location/Qualifiers
FT   CDS_pept        232852..233715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0250"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="PFAM: helix-turn-helix protein RpiR; sugar isomerase
FT                   (SIS); KEGG: msu:MS0198 RpiR protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68364"
FT                   /db_xref="GOA:A1AYM0"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYM0"
FT                   /protein_id="ABL68364.1"
FT                   /translation="MMGHYDPRTVGAQIRMKLPFLTPLEARVVDTITGRNDLDLTTALR
FT                   QVSEDAGVSDAMVVKIAKKLGFNGFRDFREALVVYRQTDVASLHSEISPEDSSADIIRK
FT                   VFQTSIQALEETMSIIDVSAFDRAATLLHGARQRDFYGVGGSAQIARDVAHKFLRIGLR
FT                   AGVQDDPHMMLMSAALLGPEDVVVAFSHSGTTSNVIEAARLARQQGARVIAITNYATAP
FT                   LSELADIALCSTAQGSPLLGENAAARIAQLNIMDAIFVAVAQRDLERAEAQLARTRNAV
FT                   DNKRRR"
     atgatgggac attacgatcc gcgcacggtg ggcgcccaga tccggatgaa gcttccgttt        60
     ctgactccgc tggaggcgcg ggtcgtcgat accattaccg gccgcaacga cctggacctg       120
     accaccgccc tgcggcaggt atccgaagat gccggcgttt ccgatgccat ggtggtcaag       180
     atcgcgaaga agctgggctt caacggtttt cgggacttcc gcgaagctct ggtcgtctat       240
     cgccagaccg atgtcgcgtc cctgcacagc gagatatcgc ccgaagacag ttcggccgac       300
     atcatccgca aggtgttcca gacctcgata caggcgctgg aagaaaccat gtccatcatc       360
     gacgtctcgg ctttcgatcg cgcggccacc ctgctccatg gcgcgcggca gcgcgatttc       420
     tacggcgtcg gcggctcggc ccagatcgcg cgggatgtgg cgcacaagtt cctgcgcatc       480
     ggtcttcgcg ccggggtcca ggacgatccg cacatgatgc tgatgtccgc cgccctgcta       540
     gggccagagg acgtcgtggt cgcattcagc cattccggca ccacctcgaa cgtgatcgag       600
     gccgcacggc tggcccgcca gcagggggcg cgggtgatcg cgatcaccaa ttacgccacc       660
     gcgcccctgt ccgagctggc cgacatcgcg ctgtgttcga ccgcgcaggg ctctcccctc       720
     ctgggcgaaa atgccgccgc gcggatcgcg caactgaaca tcatggacgc gatctttgtc       780
     gccgtcgcgc agcgcgacct ggaacgggcc gaggcgcaac tggcccggac ccgcaatgcc       840
     gtggacaaca agcgccgcag ataa                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page