(data stored in ACNUC7421 zone)

EMBL: CP000489.PE248

CP000489.PE248       Location/Qualifiers
FT   CDS_pept        233732..234574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0251"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: msu:MS0197 RbsK
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68365"
FT                   /db_xref="GOA:A1AYM1"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYM1"
FT                   /protein_id="ABL68365.1"
FT                   /translation="MARTSCAVVVGSLHYDIVVSAPHRPAAGETVTGTAWHPVFGGKGG
FT                   NQAVAVVRAGVACRIVSAVGDDDFGLFLRGHLEASGVDAAHVATLPGTGSGMSVAIMDA
FT                   GGDYGAVIVSGANLAIDPAVLDRDALWDGASHLVLQNEIPEALNIAAARAARARGLRVV
FT                   LNAAPARDLSADLAATIDILVVNAGEAEALSGIVVESLEDARHAASALADRFRIVVVTA
FT                   GTEGAHSEPGRRVKLVSTHGAGDCFIGTLVAELAHGGDLRYSVRQANLAAAKHVSRAE"
     atggcccgca cttcctgcgc tgtcgtcgtc ggcagcttgc actatgacat cgtcgtctcg        60
     gcgccccatc gcccggcggc gggcgaaacc gtcaccggca cggcctggca cccggtcttc       120
     ggcggcaagg gcggcaacca ggcggtcgcg gtcgtgcggg ccggggtggc gtgccggata       180
     gtctcggccg tgggggacga cgatttcggc ctgttcttgc gcggccatct ggaggcctcg       240
     ggggtggacg ccgcccatgt cgccacattg cccggcaccg gctcggggat gagcgtcgcg       300
     atcatggatg ccggcgggga ttacggcgcg gtgatcgtct cgggcgccaa tctggcgatt       360
     gatccggcgg ttctggaccg cgatgcgcta tgggacgggg ccagccatct ggtcctgcaa       420
     aacgagatcc ccgaggcgct gaacatcgcc gcggcccgcg ccgcgcgggc gcgcgggttg       480
     cgcgtagtgc tgaacgcggc gccggcccgt gacctgtccg ccgatctggc cgcgacgatc       540
     gacattctgg tcgtcaacgc gggcgaggcc gaggcactga gcggtatcgt ggtcgaaagc       600
     cttgaggatg cccggcacgc agcatccgcc ttggcagatc gcttccgtat cgtcgtcgtg       660
     acggccggca ccgagggcgc acattccgaa cccggacgca gggtaaagct ggtcagtacc       720
     cacggcgctg gcgactgctt catcggcaca ctggtcgctg aacttgccca tggcggtgac       780
     ctgagataca gcgtcaggca ggccaatctg gcggcggcga aacacgtctc acgggctgag       840
     tga                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page