(data stored in ACNUC7421 zone)

EMBL: CP000489.PE251

CP000489.PE251       Location/Qualifiers
FT   CDS_pept        235511..235789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0254"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68368"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYM4"
FT                   /protein_id="ABL68368.1"
FT                   /translation="MGYIMQQAMGRGTRLIASIVGCAPPQPNSTILSASYAQAPVTAGA
FT                   LFFCGQHLVNIRGLPETRRCRRARMVSDEGIWEAITVMTSRAKKSGA"
     atgggttaca ttatgcagca agctatggga cgtggcactc gattaatcgc aagtatcgtt        60
     ggttgcgcgc ccccgcaacc aaattccaca atattatcag catcttacgc gcaagccccg       120
     gtcaccgccg gggctctgtt tttttgcggt caacacctgg tcaacattcg gggcctgcca       180
     gagactcggc ggtgccgacg agcgaggatg gtcagcgatg aaggaatatg ggaagcgatc       240
     acagtgatga ccagccgagc aaaaaaaagc ggcgcatag                              279
//

If you have problems or comments...

PBIL Back to PBIL home page