(data stored in ACNUC7421 zone)

EMBL: CP000489.PE252

CP000489.PE252       Location/Qualifiers
FT   CDS_pept        236307..236864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0255"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68369"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYM5"
FT                   /protein_id="ABL68369.1"
FT                   /translation="MMDMIARLRAERQDLVARLGEIDKILTQYKQIERAAQQLLGDHPP
FT                   VDSRAMTAGPVEPVAPHTPATVPDRAVSAKNKTPIEEFEQAVIDVLQETAAPLNRVQLY
FT                   DALTDRGIVIGDGDREKELNALSARVYRMTQTGRLTSRRGQGYSLKADGDVDGPRYDPQ
FT                   QEDLPRHQEVREADERDDELLG"
     atgatggata tgatcgcacg tttgcgggcg gagcggcaag atcttgtggc gcgtctaggt        60
     gagatcgaca agattttgac gcagtacaaa cagatcgaac gtgctgcgca acagctttta       120
     ggtgaccacc caccggttga ttcgcgggcg atgacagcag gacctgtaga gcctgttgcg       180
     ccacatacgc cagctacagt gcctgaccgg gcggtcagcg cgaagaacaa gactccgata       240
     gaggaattcg agcaggcggt tatagacgtg ctgcaagaga ccgctgcccc cctgaaccgt       300
     gtgcaactct atgatgcatt gacggaccga gggatcgtga tcggggacgg tgatcgcgag       360
     aaggaactca atgcgctatc ggcaagggtc tatcgcatga cgcaaacggg taggctgaca       420
     agccggcgtg ggcagggata tagcttgaaa gctgatggtg atgttgatgg ccctcgttac       480
     gatcctcaac aagaggacct tccgcggcat caagaggtcc gagaggcaga cgaacgagac       540
     gacgaactgc tcggttga                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page