(data stored in ACNUC7421 zone)

EMBL: CP000489.PE257

CP000489.PE257       Location/Qualifiers
FT   CDS_pept        complement(238789..239064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68374"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYN0"
FT                   /protein_id="ABL68374.1"
FT                   /translation="MNGCIVQVWFEPETDTPGRCAPFVIIETELPDFASFCELVDADRL
FT                   IGGGILWTRNGSPGEKVIYRRQPCAFRGSAVLRCQLPTWRFIEGDS"
     atgaacggtt gcattgtgca ggtatggttt gagccggaaa ccgacactcc gggtcggtgc        60
     gcgcctttcg tgatcatcga gaccgaactc cccgacttcg ccagtttctg cgaactcgtg       120
     gatgcggatc gcctgatcgg cggcggcatc ctgtggaccc gcaatggctc gcccggagaa       180
     aaggtcatct accggcgtca accttgcgcc ttccgggggt cggccgtgct gcgctgccag       240
     cttcccacct ggcgtttcat cgagggggat tcgtag                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page